SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021675 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021675
Domain Number 1 Region: 222-285,337-368
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000279
Family Second domain of FERM 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000021675
Domain Number - Region: 114-208
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00031
Family Ubiquitin-related 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021675   Gene: ENSCAFG00000014679   Transcript: ENSCAFT00000023342
Sequence length 507
Comment pep:novel chromosome:CanFam3.1:9:20317324:20320930:1 gene:ENSCAFG00000014679 transcript:ENSCAFT00000023342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGVLQTCRDLPALRDELFLQLAKQTSGPAGPPGPPATQDPAALRYWQLLTCMSCTFRPG
GAVRGHLLGHLERTEQALPDSELAEYARFIRKALGRTRGRELVPSLAEISALSRRQELLC
TVHCPGAGACPVTIDSHTTAGEVARELVGRLGLARSRNAFALYEQRGAQERALAGGTLVA
DVLTRFENLAAEEAGVDDSADSGWRLCLRLHGPLHPEGLSPDGHELPFLFEQAHALLLRG
RPPPPDDTLRALAALRLQSLHRDFSPRAPLPRLDRLLPPPAPPREDPPRPVPRPPPSAAL
LAGAIWSPGLAKRRAERTRRGGGAGGTAGSVAREGGGGAGTAAAVLGSWKRLRGMGRAEA
MAAYLALAAQCPGFGAARYDVLELSTEPGGGTPQKLCLGLGAKAMSLSRPGETEPIHSVS
YGHVAACQLMGPHTLALRVGESQLLLQSPQVEEIMQLVNAYLPNPSPERPCSSPSPCQDL
PDTSPPSQRPGLDEPQGQSGCLGQLQH
Download sequence
Identical sequences F1P775
ENSCAFP00000021675 ENSCAFP00000021675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]