SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022401 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022401
Domain Number 1 Region: 354-441
Classification Level Classification E-value
Superfamily DEATH domain 4.42e-24
Family DEATH domain, DD 0.0000125
Further Details:      
 
Domain Number 2 Region: 101-143
Classification Level Classification E-value
Superfamily TNF receptor-like 1.91e-16
Family TNF receptor-like 0.00014
Further Details:      
 
Domain Number 3 Region: 44-100
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000224
Family TNF receptor-like 0.0000247
Further Details:      
 
Domain Number 4 Region: 145-198
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000659
Family TNF receptor-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022401   Gene: ENSCAFG00000015197   Transcript: ENSCAFT00000024129
Sequence length 452
Comment pep:known chromosome:CanFam3.1:27:38642113:38654160:1 gene:ENSCAFG00000015197 transcript:ENSCAFT00000024129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPTVPGLLLPLVLLALLLEIYPISVTALVPHPRNRVKRAILCPQGKYIHPQDDSICCT
KCHKGTYLYNDCPGPGLDTDCRECENGTFTASENHLRQCLSCSKCRKEMNQVEISPCTVY
RDTVCGCRKNQYRFYWSETLFQCNNCSLCLNGTVQISCQEKQNTICTCHAGFFLREHECV
SCVNCKKNTECGKLCLPPVETVKVPQDPGSTVLLPLVILFGICVLSFSIGLMCRYQRQKP
RLFSIVCGKPTPTKEGEPESRASVPGFSPTTGFSPVPNPTCTPRSILTPSPTFTPSDWPN
GRAAPVSREMAPPCQGAGPILTSAPASTPIPTPVQKWEDGTATPRTEADPADPATLYAVV
DGVPPSRWKEFVRRLGLSEHEIERLELQNGRCLREAHYSMLAAWRRRTPRREATLELLGR
VLREMELLGCLEDIEEALCAPAALSPAPRLPR
Download sequence
Identical sequences F1PNY7
ENSCAFP00000022401 XP_854474.1.84170 ENSCAFP00000022401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]