SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022430 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022430
Domain Number 1 Region: 204-381
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-33
Family APC10-like 0.0025
Further Details:      
 
Domain Number 2 Region: 1821-1880
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000271
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1778-1829
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000612
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 91-148
Classification Level Classification E-value
Superfamily EF-hand 0.0000158
Family Calmodulin-like 0.043
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000022430
Domain Number - Region: 1085-1193
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000105
Family Spermadhesin, CUB domain 0.0061
Further Details:      
 
Domain Number - Region: 2709-2798
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0458
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022430   Gene: ENSCAFG00000015219   Transcript: ENSCAFT00000024162
Sequence length 2964
Comment pep:known chromosome:CanFam3.1:5:30132570:30235865:-1 gene:ENSCAFG00000015219 transcript:ENSCAFT00000024162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAPSHSSEDEAGAAGGEGWGPHQDWAADASAIPGSGPAAPALPPAAALLEPARLREAA
AALRPAPPCESLVSRHHGALLRWLEERLGRGEEAVTLEQFRELLEARGAGCSGEQFEEAF
AQFDAEGDGTVDAENMLETLKNSSGANLQGELSHIIRQLQACSLVPGFIDIFSESKEGLG
VHASLILRFLHRNRLSGMAIPCPMLDHCSNMCSMRASVLKESLDQLVQREKESPGDLTRS
PEMDKLKSVAKCYAYIETSSNPADIDKMTNGETSSYWQSDGSARSHWIRLKMKPDVVLRH
LSIAVAATDQSYMPQQVTVAVGRSASDLQDVRDVHIPSNVTGYVTLLENANISQLYVQIN
IKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQT
VLHNTQKALQHMPPLSLSPGSTDVSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFA
LARGSVAKVLSCLCTIADHLDTRYDASSLISSMASVRQTLLLKYGKPLQLTLQACDVKGK
EEKSGPENLLVEPWTRDGFLTETGKTRASTIFSAGTESAFQVTQIRIMVRRGGIGAQCGL
VFAYNSSSEKFHAEEHFKRFEKYDKWKLQEFRQFVKSRVGCSADDLGEDDPIGWFELEEE
WDEADVKLQQCRVAKYLMVKFLCTRQESAERLGVQGLSISGYVRPMRVEAEQHIVCAHCR
KDGEESVCGTTLLLRTLQFTQQLAHDLVQQKESGLKYKSFLDFAGLDLQIFWNFYSKLKQ
NPREECICAQTLLLRLLQSCLSVLQRDGPATPEEAKAPRQSPGGAGAAKELHAHLCDVVD
RVDGDSVPMETLKQEVRNTLLSGAAVFFPDRQSRRSHLFTMMKNVTEQEHKQSQQLTFQS
LCTYFSDKDPGGLLLLPEKGDLADMNSSEVLAVMSTLLSVAARECELLLLTRAQGQPGSV
LFSLFWAVQGSLLSWCYLQLKSTDAGARGLAAHLIDQYVGQFVASTRVILESLLSQYSGQ
TIVEKLCNSVFSMAARQLVIFLLDFCTLDISHCALLREFSTLTELLKQICADPTGAPDKL
DEDTWQQECPVVLHTWTKESAHNYENNCHEVSVFISPGATYFEVEFDERCETEKRYDYLE
FTDARGGKTRYDTKVGTEKWPRKVIFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVA
VSWALDLQLLVCRLMGRLAAQCMALKSAHQFGGDMAVAPAKMALVLNSPLWKPVFRHQLS
PELGLAVSWPTHLHQDSKEVKNIPDDPCHHFLLEFAQSDPAQNFCGPFSELFKGFIQACR
KQAPKTDIVAGSTIDQAVNATFAALVCRTPGLYEKLQKYVNSGGNTALSEDFAQVYCLAD
GIRVWMLEMKQKSLMNLGNEAEEKHGPEAAEANPESLAKECIQKSLLLLRFLPMGVSSKE
SCDKLVAAVETDHLQPCDRCPRTSSVVEEHFQASESPMDTGTLAASSGGPSSDVPLKLLP
SGGPPATEVSFATAEEPSSPSAPARRPPFTRGRLRLLSFRSVEEARPVPTVKEKYPVLKD
VLDFIKDQSLSHESVVKVLALRKAQAQSILEVLRIIQYCTESLGRPHCFHPPCILFLMEL
LTCQKEFTNYFAHMEGCGARLRKEIRDTYYQFVLFLVKAVKEFSSMNDRSLLPALSCVQT
ALLHLLDMGWEPGDLAFFVDIGLPHLLMKLSQENISVHDSVISQCSEEDELADAKQNSEW
MDECQDGMFEAWYEKIAQEDPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQ
CSDMDLCKTCFLGGVKPEGHGDDHEMVSMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCY
AAKRYSYGHLPTHGVTAHPMVTIRISDRQRLIQPYIHNYAWLLFAALALYSAHLASAEDV
DGEKLNPQDRGSASLLRSQCMQLVGDCLMKAHQGKGLKALALLGILPDGEPSPESRAPPV
TVPTHTAEEERAVWGPEDLPHTGLSMCYSGKEDGPKEVRPLDSRQRSKADEEGASLMNGP
SCQTPISDTPADGSTPARLPDAENTVMLSQESIEEKAVTPSPEQVFAECSQKRILGLLAA
MLPPLKLDPTVPVIDLEHVLPLMFQVVISNVGHLNETYHLTLGLLGQLITRLLPAEVDAA
VVKVLSAKHTLFATGDSSVVPDGWKTTHLLFSLGAVCLDSRVGLDWACSMAEILRSLNSA
PLWRDVIAAFTDHCIRQLPFQLKHTNIFTLLVLVGFPQVLCVGTRCVYVDHANEPHNVII
LKHFTEKNRAVIVDVKTRKRKTVKDYQLVQKGQECSSSQAQLSQYSRHFAFIASHLLQTS
MDSQCPEAVEATWVLSLALKGLYKTLKAHSFEETHTTFLQTDLLKLLVKKCSKGTGFSKT
WLLRDLEILSIMLYSSKKESHTSAEHTALERDERGDQEEEVDGTVSSPGEPDQKKLDPLE
SLDEPTRICFLMAHDALNAPLHILRAIYELQMKRTDSFFLEVQKRFDGDELTTDERIRTL
AQRWQPSRGLRLEEQSTKAVDTDMIILPCLSRPARCDQATAESNPVTQKLISSTESELQH
SYAKQRRSKSTALLHKELNGKSKRAIREYLFRVNEATAVLYARHVLASLLAEWPGHVPVS
EDTLDLSGPAHMTYILDMFMQLEEKHQWEKILRKVLQGCRGSMLGTMALAACQFMEEPGM
EVQVRESKHPYNNNTSFEDKVHIPGAIYLSIKFDSQCSTEEGCDELAMSSSSDFQQDRHT
FSGSQQKWKDFELPGDTLYYRFTSDMSNTEWGYKFTVTAGHLGRFQTGFEILKQMLSEER
VVPHLPLAKIWEWLVGVACRQTGHQRLKAIHLLLRIVQCCTHSDLCDLALLKPLWQLFTH
MEYSLFEDVTSPGILLPLHRALTELFFVTENRAQELGLLQEYLLALTTDDHLLRCAAQAL
QNVAAISLAINYPNKATRLWNVEC
Download sequence
Identical sequences F1PN79
ENSCAFP00000022430 XP_005619923.1.84170 ENSCAFP00000022430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]