SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024167 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024167
Domain Number 1 Region: 468-532,574-671
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-31
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 2 Region: 680-804
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1092-1224
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-18
Family Second domain of FERM 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000024167
Domain Number - Region: 37-128,579-599
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000418
Family BAR domain 0.055
Further Details:      
 
Domain Number - Region: 993-1070
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000428
Family Ubiquitin-related 0.049
Further Details:      
 
Domain Number - Region: 1225-1286
Classification Level Classification E-value
Superfamily PH domain-like 0.0017
Family Third domain of FERM 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024167   Gene: ENSCAFG00000016410   Transcript: ENSCAFT00000026029
Sequence length 1363
Comment pep:known chromosome:CanFam3.1:8:41508763:41556447:1 gene:ENSCAFG00000016410 transcript:ENSCAFT00000026029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELKVETRASVDWQKRCLALETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDLGGSLHQKYQELLKAMQSKDELISQLEAQLEKQKQMRAEE
AKVVQEKAAKIKEWVTLKLAELEMENQHLKSSNQHLAEQVGVLQDALEALQMAPSGKLLV
ATQEIPEQDSGPSGPGTQPIGQDSGPQAQGALKATMAAPSPDALQSKDSVSPGISLEDSS
PIVVHPGEISDSKALPLHLGEGSPRRLCMKPRTHRHGSASWGEGLVIAQGGTLPGTKNSA
REGSPGCSLTLPKVRVPSTPRDSIQLAKRHHSQPQVGPGHFNHVVSIEIGTLSALHPSSL
PEVEARAELREEPENVEMEEQPPMAKEKERESPKAPRAELEEVDLGNKPPTPPLHRFPSW
ESRIYAVAMAGMRLSDASSRTNVTCCASSPPALASPGPFSGLVYKNVTVPVYTALKGRAT
QISSVPFMDESSGSDDDCSSQASFRSSVPCSESRKTSGLGSPRAIKRGVSMSSLSSEGDY
AIPPDACSLDSDYSEPEHKLQRTSSYSIEGPGLGGESLEKSGYLLKMGSRVKTWKRRWFV
LRQGQIMYYKSPSDVIRKPQGVVELNSHCQIVRGEGAQTFQLISEKKTYYLTADSPGLLE
EWIRVLQSLLRVQAVGPPALPRGGTKPTVKGWLTKVKHGHSKLVWCALVGKTFYYYRSHE
DKRPLGHLPVRDARIEEVDRSCDSDEDYEAGGSRRLLSSHCTLVIHPPEHSPTYLLIGTK
HEKDTWLYHLTVAAGGSSARVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYTSL
TTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQL
MKQTSCRPPQKYSLVQCWQLLALCTPLFLPQHHFLWYVKQQFQRHADPRNETGQYATYCQ
RAVERTLQAGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYQVVGFDGSSTVDE
FLQRLNQETGMRKSSHSGFALFTDDPSGRDLEHCLPGGVKICDAISKWEQALKELHSGKA
EGGTRVVKLMYKNRLYFRSQVKGETERERLLLASQTSGEIVAGRFPVNKELALEMAALMA
QVEYGDLERPSPPGPGSPLPAKVQHHLQHVLDRFYPRRYRHGAPSEQLRHLADLLTTKWA
ALQGCSPPECIRIYLTVARKWPFFGAKLFAARPAQLSSKESTLVWIAVNEDGVSILDHNT
MQVHVTYPYSSVMTFGGCRDDFMLVIRSIPDQGSGKGHIEKLLFQMAAPKIAEATFIMAS
YMNHCSTTVNTPPNPPAAHQLWELDGQQFFASVPCAARGPTLL
Download sequence
Identical sequences E2R9H2
XP_537487.3.84170 ENSCAFP00000024167 ENSCAFP00000024167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]