SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024620 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024620
Domain Number 1 Region: 424-685
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.68e-77
Family Eukaryotic proteases 0.0000000485
Further Details:      
 
Domain Number 2 Region: 26-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-29
Family Spermadhesin, CUB domain 0.00000116
Further Details:      
 
Domain Number 3 Region: 184-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-27
Family Spermadhesin, CUB domain 0.00000248
Further Details:      
 
Domain Number 4 Region: 300-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.12e-16
Family Complement control module/SCR domain 0.00031
Further Details:      
 
Domain Number 5 Region: 366-436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0000239
Further Details:      
 
Domain Number 6 Region: 135-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000189
Family EGF-type module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024620   Gene: ENSCAFG00000016744   Transcript: ENSCAFT00000026513
Sequence length 686
Comment pep:novel chromosome:CanFam3.1:2:84976089:84987370:1 gene:ENSCAFG00000016744 transcript:ENSCAFT00000026513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLFLGLLCGWAAAAPGPAWSQPLFGRLASPGFPGAYANHQERRWALTAPPGYRLRLY
FTHFHLELSYLCEYDFVKLSSGTEVLATLCGQESTDTERAPGNDTFRSPGSSLDVTFRSD
YSNEQPFTGFEAFYAAEDIDECQVSPGEAPPCDHHCHNHLGGFYCSCRQGYVLHRNKRTC
SALCAGQVFTGRSGVLSSPEYPQPYPKLSSCTYSIRLEEGFSIVLDFVAPFDVESHPDAL
CPYDSLQVRTDKEEYGPFCGTTLPRRIETQSSAVAISFVTDQSGEHAGWRIRYSSSARPC
PSPVAPPNGRITPVQAEYVLEDRVAVSCDPGYELLRGSSALESFTAVCQRDGSWDQPPPR
CSAVDCGPPDDLPAGRVDFLTGPGVTTYGAGIRYHCDGSFYAMTAGDGKYVCEADGFWTS
SKGEKSPPVCEPVCGVSTRTTEGRIYGGQKAKLGDFPWQVLLLGRTTAAGALLRDNWILT
AAHAVYTQKAAASSLDIRMGALKRLSAQYTQARAEAIFIHEGYTPDAGFDNDIALIKLKN
RVVINSNVLPICLPRKEAESFMRSEDIGTASGWGLTQRGFLARHLMFVDIPIVDHQKCTA
AYEKLSYPGGRVTENMLCAGLEGGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSTNC
GEANQYGVYTKVINYIPWIENIINNF
Download sequence
Identical sequences F6USM4
ENSCAFP00000024620 ENSCAFP00000024620 XP_544572.4.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]