SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025076 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025076
Domain Number 1 Region: 724-939
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-104
Family Thrombospondin C-terminal domain 0.0000000879
Further Details:      
 
Domain Number 2 Region: 597-722
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.88e-34
Family TSP type-3 repeat 0.00000384
Further Details:      
 
Domain Number 3 Region: 516-599
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.88e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 225-270
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000109
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 5 Region: 445-540
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000706
Family TSP type-3 repeat 0.00016
Further Details:      
 
Domain Number 6 Region: 309-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000152
Family EGF-type module 0.024
Further Details:      
 
Domain Number 7 Region: 52-152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000657
Family Laminin G-like module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000025076
Domain Number - Region: 368-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000652
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 416-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0355
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 275-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025076   Gene: ENSCAFG00000017017   Transcript: ENSCAFT00000026973
Sequence length 956
Comment pep:novel chromosome:CanFam3.1:7:42328630:42338756:1 gene:ENSCAFG00000017017 transcript:ENSCAFT00000026973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGALALLLLCTFASASQDLQVIDLLTVGESRQMTAVAEKIRAALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPAQPNPALQLYVDCKLGDQHAGLPGMAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHSAVTNALQSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCTDINECAHADPCFPGVSCINTMPGFHCEACPRGYKGTRVSGVGIDY
ARASKQVCNDVDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCFPARTCHS
PAHSPCHVHAHCLFERNGAVSCSCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGVPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTAMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQERV
Download sequence
Identical sequences E2QYM7
ENSCAFP00000025076 ENSCAFP00000025076 XP_003434941.1.84170 9615.ENSCAFP00000025076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]