SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025805 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025805
Domain Number 1 Region: 275-378,420-691
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.22e-146
Family Myotubularin-like phosphatases 0.0000000619
Further Details:      
 
Domain Number 2 Region: 1228-1295
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.65e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 169-250
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000026
Family GRAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025805   Gene: ENSCAFG00000017513   Transcript: ENSCAFT00000027755
Sequence length 1313
Comment pep:novel chromosome:CanFam3.1:9:33108360:33135301:-1 gene:ENSCAFG00000017513 transcript:ENSCAFT00000027755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVRRSWGPRVGGALCSVKNTFPSLPSNNIS
KGSSTGALASCFRVSRGRGICVCALWSLWPQGRKGSFPVRLLPGAATVERTLLFFLGPTF
PVGIPQVKVGEGDGGVTYFWTEGPSAPRQVPFAVLQGEGVEFLGRAADALIAISNYRLHI
KFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFKQCQEWLSRLSRATARPA
KPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELTRMGFDLQNVWRVSHINSN
YKLCPSYPQKLLVPVWITDKELENVATFRSWKRIPVVVYRHLRNGAAIARCSQPEISWWG
WRNADDEYLVTSIAKACALDPGTRATGGPLSTGNSDASEACDTDFDSSLTACSGVESTAA
TQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAVCSQ
MPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVALAK
ILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAEDQNEQCPVFLQWLDSVHQLLK
QFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKNFH
NFLYTPGSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEETMDLYLSPVAQSQEFSGRSL
DRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQETRVGLEPWHSNPEGSETFVESGI
GGPQQTVGEIGLPSSLPSSQKDYLSNKPFKSHGSCSPSYKLLSTAVPQGMKSNVSDPEIK
VLEETKEPAPDPPASNELSRTLDGTEEPPEHCPEKEAVSTLSEVVSNKCNGVCDFPESSQ
DSLTGAPQRALLDSMLGVPFRCVPDHSLGTLCSPLSATCQTPPEPSTDFLSQDPPGSVAS
ISHQEQPSSVPELIHREEYTGKRGNNRNGQLLENPRFGKVPLELTRKPISQSQISEFSFL
GSNWDSFQGMVTSFPSGETTPRRLLSYGCCSKRSNNKQVRATGPCFGGQWAQREGVKSPV
CSSHSNGHCTGPGGKNNRMWFSSHPKQVSGTKPVPLSCPSPVPPLYLDDDGLPFPTDVIQ
HRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFTCLKESDGSDIE
DFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCEFWLAKRRHHCRNCGNV
FCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQHLKKPIATASS
Download sequence
Identical sequences F1PMP2
ENSCAFP00000025805 ENSCAFP00000025805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]