SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026847 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026847
Domain Number 1 Region: 3162-3336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.85e-32
Family Laminin G-like module 0.00097
Further Details:      
 
Domain Number 2 Region: 2991-3154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.23e-29
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 2591-2763
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-23
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 4 Region: 2765-2932
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-22
Family Laminin G-like module 0.0081
Further Details:      
 
Domain Number 5 Region: 2391-2583
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000019
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 6 Region: 1742-1792
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000273
Family Laminin-type module 0.055
Further Details:      
 
Domain Number 7 Region: 1359-1410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 536-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 9 Region: 1269-1317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000212
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 10 Region: 491-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 11 Region: 1690-1731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 12 Region: 299-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 13 Region: 631-681
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 14 Region: 356-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 15 Region: 1408-1456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 16 Region: 426-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000698
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000026847
Domain Number - Region: 1651-1692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00026
Family Laminin-type module 0.04
Further Details:      
 
Domain Number - Region: 684-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000318
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 112-224
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000548
Family APC10-like 0.051
Further Details:      
 
Domain Number - Region: 586-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00218
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number - Region: 1321-1356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 1842-2001
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.022
Further Details:      
 
Domain Number - Region: 2267-2382
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0246
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.039
Further Details:      
 
Domain Number - Region: 2110-2203
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 0.0837
Family Variable surface antigen VlsE 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026847   Gene: ENSCAFG00000018173   Transcript: ENSCAFT00000028869
Sequence length 3337
Comment pep:known chromosome:CanFam3.1:7:64405533:64655273:-1 gene:ENSCAFG00000018173 transcript:ENSCAFT00000028869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARAPGWPSRPVLLLLLLLLPPSLLPAAGTAREPRAAARLSLHPPYFNLAEAARIWA
TATCGEREPGGARPRPRPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAI
DGSESWWQSPPLSSGTQYNKVNVTLDLGQLFHVAYLIIKFANSPRPDLWVLERSVDFGST
YSPWQYFAHSKVDCLEQFGQKANMAITQDDDVLCTTEYSRIVPLENGEVVVSLINGRPGA
KNFTFSHTLREFTKATNIRLCFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGRCV
CNGHAQECNANNPEKLFQCECQHHTCGKTCDRCCAGYNQRRWRPATWEQSNECEACNCHG
HAIDCYYDPDVERQQASLNIHGIYAGGGVCINCQHNTAGINCENCAKGYYRPYGVPVDAP
HGCIPCSCNPEHADDCEPGSGRCTCKPNFQGDNCEKCAVGYYNFPFCLRIPIFPVSTPSP
EDPVAGDIKGCDCNWEGVLPEICDAYGRCLCRPGVEGPRCDACRVGFYSFPICQACQCSV
LGSYQTPCNPVTGQCECQPGITGQRCDRCLSGAYDFPHCQGSRSVCDPAGTLDSSLGYCQ
CKPHAESPSCSICKPLYWNLAKENPNGCSECQCHVAGTVSGIGECGQRDGDCHCKSHVSG
DSCDTCEDGYFALKKSNYFGCQGCQCDIGGAVTPMCSGPSGGCHCREHVVGKACQRPENN
YYFPDLHHMKYEIEDGTTPNGRELRFGFDPLEFPEFSWRGYAQMTSVQNEVRIMLNVGKS
SLSLFHVILKYINPGTEAVSGHVTLYPSWAEAGAAQSKEVIFLPSKVPAFVTIPGNGLAD
PFSIAPGTWIACIKSEGVLLDYLVLLPRDYYEASSLQLPVTQPCADSGPPQENCLLYQHL
PVTRFPCALACEARHFLLDGEPRPLALRQPTPAHPVMADLSGREVELHLRLQVPRVGNYV
IMVEYSTEVDQLSEVDVHMESPGSVLIGQVNIYSCKYSVLCRSVVTDGRSGLAVYELLAD
AGIRLKAHRGRFLLHQICIIPIEEFSTEYLRPQIKCIASYGGYINQSASCVSLVPETPPT
ALILDVPSGESSPLLTQDPSPSADIVTGVTLKMPQNQVTLRGLVPHPGRYVIVIHFYQSA
HPTFPTQVFVDGGRLWPGVFRASFCPHVLGCRDQVIAEDQVEFDISEPEVAVTVKVPEGK
SLVLVRVLVVPAEDYDYQILHKKSVDKSFEFVTNCGGNSFYIDPQTASGFCKNAARSLVA
LYHKGALPCECHPTGAIGRPCSPEGGQCPCRPSVIGRQCTRCRMGYYGFPHCKPCNCGPR
LCDEMTGKCLCPPHTVRPQCEVCDTHSFSFHPLAGCEGCNCSRRGTVGAATRECDRDHGQ
CRCKPRITGRQCDRCASGFYHFPECIPCHCNKDGTESGVCDPGTGVCLCKENVEGTECNV
CREGSFYLDPANPKGCTSCFCFGINSHCHSTHKRRAKFVDMMGWRLETVDRAHIPVSFNP
GSSSVVADLQELPSTVHSASWVAPPSYLGDKVSSYGGYLTYQIKSFGLPGDMVLLEKKPD
VQLTGQHMSIIYEEPNNPRPDRLYHVRVQVVEGNFRHASSSAPVSREELMMVLSRLEDLR
LRGLYFTETQRLSLSGVGLEEASDTGSGRRAHNVEMCACPPDYTGDSCQGCSPGYYRDNR
GSYTGRCVPCNCNGHSNRCQDGSGICINCQHNTAGEHCERCKEGHYRNTIHGSCSVCPCP
HSNSFATGCVVTGGNVRCSCKPGYTGTQCERCAPGYFGNPQKFGGSCQPCNCNSNGHLSS
CHPLTGDCINQEPKDDSPAEECDDCDSCVMTLLNDLATMGNELHLVKSQLQGLSASTGTL
EQMKHLETQIKDLRNQLFNYRSAISNHGLKMDGLEKELGNLNREFETMQEKVQINSRKAQ
TLHNNVDRTTQSAKELDTKIKNVIQNVHILLKHISGTDGEGNNLPSGDFSRELAEAERMM
TELRNRNFGKHLREAEAEKTEAQLLLTRIRSRLEKHQVENGALVKNMRDSLNDYEAKLSD
LRALLQEASAQAKRATGLNRGNEKTLESLERQVKEMNSLQSDFSKYLTTADSSLLQTNTL
LQLMGKSQEEYEKLAATLNEKRHELNDKVRELSQSASKASLVMEAEKHAQSLQELAKQLE
EIKKNASGDELVRCAVDAATAYENILNAIKAAEDAADKATRASESALQTVIKEDLPRKAK
TLSSDSDKLLKQTKITQKKLQQEISPALNNLQQTLKVMTVRKGLIDTNITVIRDDLRGIQ
RDDISGMISSAKSMVRNANDITDEVLDGLSPIQTDVARIKDTYGSKQSEDFNKALADADN
SVKKLTNKLPDLLSKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAVPMRFNGKS
GVEVRLPNDLEDLKGYTSLSFFLQRPESRESGRTENMFVMYLGNKDISRDYIGMAVVDGR
LTCVYNLGEQESELQVDQSVIKSETQEAIMDRVKFQRIYQFASLNYTKKATSSKPGSSQF
HEMDSGNSHTLLNLDPENIVFYVGGYPSDFTLPARLRFPPYKGCIELDDLNENVLSLYNF
KKTFNLNTTEVEPCRRRKEESDRNYFEGTGYARVPTQLNAPNPNFGLTIQTTVDRGLLFF
AENQDRFISLNIEDGKLLVQYKLNSEPPKEREIGHIVNDGKDHRILIVIGKFQNRISIAV
SSQNSQIDGDIFDFSTYYLGGIPISIRERFNISTPAFRGCMKNLKKTTGVVRLNDTVGVT
KKCSEDWKLVRSASFSRDGQLRFTGLDLPLPSEFQASFGFQTFQPSGILFNLQSQKHSLQ
VTLEDGRIELNTRENSLIIRSPQTYMDGELHYVSVIGDNSGLRLLIDDQTLKSNQKLQDL
SGSQHPLYLGGSQFEGCISNVFIQRVSKSPAVLDLASKTFKRDVSLGGCSLNKPPFLMLL
RGSTRLNKSHTFNINQPLQDTPVASPRSMEMWREAQSCLPPPQAPTSPGAFSFGDSPTSH
LQFTIPQELVKPRSRFAVDVQTASSRGLVFYTGTKNSYMALYLSKGRLIFALGAGGKKLR
LKSKEKCNDGKWHTVVFGQDDKKGHLIVDGLRAREGSLPGNSTFSLTAPVYLGSSPAEKP
KSLPQNSFVGCLRNFQLDLKPLDTPSASVGVSPCLGGSLEKGIYFSQEGGHVILANSVLL
GPEFKLVFSIRPRSLTGILMHVGSQPGRYLCVYMEAGKVTASVDSEAGGILTSITPKRSL
CDGRWHSVTVTIKQHIVHLELDSENSYTTGRLPFPSASTQEPIHVGGIPANLKTLKLPVW
KSFFGCLKNVQVNHIPIPVTEALDVQGTVSLNGCPDH
Download sequence
Identical sequences E2RPP1
XP_537297.2.84170 ENSCAFP00000026847 ENSCAFP00000026847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]