SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027065 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027065
Domain Number 1 Region: 1190-1937
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-256
Family Motor proteins 0.00000000036
Further Details:      
 
Domain Number 2 Region: 2856-2939
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000544
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 3 Region: 3286-3402
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000628
Family Second domain of FERM 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000027065
Domain Number - Region: 3403-3453
Classification Level Classification E-value
Superfamily PH domain-like 0.0149
Family Third domain of FERM 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027065   Gene: ENSCAFG00000018319   Transcript: ENSCAFT00000029106
Sequence length 3518
Comment pep:novel chromosome:CanFam3.1:5:41370466:41419718:-1 gene:ENSCAFG00000018319 transcript:ENSCAFT00000029106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEEEDEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRTPKISKKGQFRSASAFF
WGLHTGPQKTKRKKKARTVLKSTSKLMTQMRVGKKKRAMKGKKPSFMVIRFPGRRGYGRL
RPRAQSLSKASTAINWLTKKFLLKKAEESGSAQATLDAWLNRGDSRVGSRKLPFPSGAEI
LRPGGRLRRFPRSRSIYASGEPVGFLPFEDEAPFRPSGSRRSLYGLEGFQDLGEYYDYHR
EGDDFYDRQSLYQYEEEQEPYVGYGPYGPAWPPYGDHAHGYPPGDPYEYYHPDYYSGPYH
PTYPYGYGYDDYEPPYAPPAGYASPYSYYDGYHGDLYPRGYYLDPYVPYAAPYPPYDLPY
DAPYLDPHGVPYGAPYGIPYAEGIYGGGDQAIYAPEVPYLYAEEPALGYPWVPPPILSPH
NPYAHPMDDIAELEEPEEAGGERQSTSFRLPSAAFFEQQGMDKPARSKLSLIRRFRLFPR
PQVKLFGKEKLDVTLPPSLDIPLPLGDADEDEEEEEMPPGPSGPYAHPLWGFLTPRQRNL
QRALSAFGAHRGLGFGPEFGRPPPRPATSLARFLKKTLSEKKPIPRLRSSQKARLGGPAV
REAAYKRFGYKLAGMDPERPSTPIVLRRAEARTRNNNNSHRPPSPAPRPPSHWSALLPAP
ATRRPPSPGPGPGTPPAPPFAPTLSGLPRPVSPYGSVRRHPPPWAAPAHVPLTPPASWWG
FVEPPPVAPEAPPNLLAFPGHRPSFRGSHRRPAAFGLPWPPLPSPQPSLRSLPGLGYRSP
MGGPSPQPSLRTRPFQPPFSPPPRRPHSLREPQSRRRISGRLGPPRSPVLGSPRPPSPPP
LLGHGSRFRSLNLPSRLPHTWRRRSEPPTRAVKPRVRQPFHRPPGAGSWPAAPVAAPEGR
ESQREPEDSETPWMVPPLAPSWDVDVPPTQRPPSPWPGGAGSHRGFSRPPPVPENPFLQY
VGPVPAPASQPEDPASDLTDVFLVRHHDPGPGQLVKSASSIPEKPEEEATLEGLQPPAEP
EPSTPTPPKDSQPQRKALRLSLSYPLATCEKMRATWPPWRRWGTLPSAPAPLAPTGPPGS
LPKAGERRQAGPGRFAVVMPQVQKLSAFQRVRPAALQPPVQVTQDPEPRPKPRAWSLLWS
CFWLPAEAHRPWSPLLTRPQSCRLGPGGNCLPHGGPWEEVGPKSWWNKMHSIRNLPTTRF
HEQCREDGVEDMTQLEDLQETTVLSNLKTRFERNLIYTYIGSILVSMNPYRMFGIYGPEQ
VQQYNGRALGENPPHLFAIANLAFAKMLDAKQNQCIIISGESGSGKTESTKLILRYLAAM
NQKRGITQQVSLSVAWTLEESFGKAKTVRKDNSCRFGKFAEVLQEGGMISGAITSQYLLE
KSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEISGKSDSDDF
RRLLAAMEVLGFSGEDQDSIFRILASILHLGNVYFEKYETDAQETASVVSAREIQAVAEL
LQISPEGLQKAITFKVTETMREKIFTPLTVESAVDARDAIAKVLYALLFSWLIARVNALV
SPRQDTLSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIIFQEEQEEYIREQIDW
REITFADNQPCINLISLKPYGILRILDDQCCFTQATDHTFLQKCHYHHGANPLYSKPKMP
LPEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVRSRTRVVAHLFSSHAPQATPQRL
GKSSSVTRLYKAHTVAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVVMAQ
LRYSGVLETVRIRKEGFPVRLPFQVFIDRYRCLVALKHNLPASGDMCVSVLSRLCTVMPN
MYRVGVSKLFLKEHLHQLLESMRERVLHLAALTLQRCLRGFLIRRRFRSLRHKIILLQSR
ARGYLARQRYQQMRRSLVKFRSLVHTYINHRHYLKLRAERRLRVEEARLRELEELSKREV
VAVGHLEVPAELAGLLQAVAGLRAARGPRVASVRTPRLQAEPRVTLPLDINNYPMAKFVR
CHFKEPAFGMLTLPLRTPLTRLPVECHAEAVSVFKLILRFMGDPHLYGAQENVFGNYIVQ
KGLAVPELRDEILAQLANQVWRNPSSHNAERGWLLLATCLSGFAPSSRLSKYLLKFVSDY
GQNGFQAVCQHRLMQAMGRAQQQGSGAARTFPPTQLEWIATQEKASMALDVGCFNGDQFS
CPVHSWSTGEEVAGDILRHRGLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLELLRN
FPRQKSYFIVGAEGPWAAGAEFQTLFGNSWDSDEDTPTRPQTQGCVPRVADSDGYWSHNE
DGTNRENRAQRGTATHYSDSLGEPSVPHRGLDCYLDSLFDPVLSYGDADLEKPTAIAYRM
KGGGQPGGSGSSSTEDPPRRPPEPKPKPKPIPGLDASTLALQQAFIHKQAVLLAREMTLQ
AMALQQHPLGPTPRPLPPEKPLAPEAQPKFVGTGPPAKPVLLRSAPKPLAPAPLAKAPRL
PTKPVAAPILAQDRVCPETTSPCPDLVRYSTLNSEHFPQPTQQIKNIVRQYQQPPRGGRP
EALRKDGGKGFVKRPDPHEEALMILKGQMSHPAAASGSQVPREAVALVKPVTSTPRPSTG
PTPVPPSRSLEPPEEPLQTQLHRLVNANFYGYQDAPWRIFLRKEVFYPKDTYSHPVQLDL
LFRQILHDTLSEACLRISKDERLKMKALFAQNQLDTQRPLAPESVKRAVVSTARDSWELY
FSRLFPATGSVGTGVQILAVSHMGIKLVRMGKGSREAGGQLQVLRTYSFADILFVTIPSQ
NMLEFNLASEKVILFSARAHQVKTLVDDFILELKKDSDYVVAVRNFLPEDPALLAFHKGD
IIHLQPLEPPRMGYSAGCVVRKKVVYLEELRRRGPDFGWRFGTIHGRVGRFPSDLVQPAA
APDFLQLPVEPGRGRAAAVAAAVGSTAAAWEVGRRREGPLVRAGSPDHADDGLTLPPYSM
LEFAQKYFRDPQRRPQDGLRLKSKEGRESRTLEDILCFTKTPLQESLIELSDSSLNKMAT
DMFLAVMRFMGDAPLKGQSELDVLYTLLKLCEDHEVMRDECYCQVVKQITDNTSTKQDSC
QRGWRLLYIVTAYHSCSEVLQPHFVRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRV
EHPSSMELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMALTRPEAFS
EYVIFVVTNQGQHVCPLSRCAYILDVASEMEQVDGGYMLWFRRVLWDQPLKFDNELYVTM
HYNQVLPDYLKGLFSSVPASRPSEQQLQQMSKLASLQHRAKDHSYLPSVREIEDYIPAQL
YHTMAGSAWLNLLGQHRQQTQALSPHQARAQFLGLISALPMFGSSFFFIQSCSNAAVPAP
CILAVNQNGLNFLSTETHELMVKFPLKEIQSTRTQRPTASSSYPYVEIALGDVAAQRTMQ
LQLEQGLELCRVVAVHVENLLSAREKRLTLPPSEITLL
Download sequence
Identical sequences E2RNX4
ENSCAFP00000027065 ENSCAFP00000027065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]