SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027440 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027440
Domain Number 1 Region: 2841-3032
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.24e-35
Family Laminin G-like module 0.000012
Further Details:      
 
Domain Number 2 Region: 2660-2843
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.19e-34
Family Laminin G-like module 0.0000392
Further Details:      
 
Domain Number 3 Region: 2252-2438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-33
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 2083-2252
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-30
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 2435-2633
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.24e-29
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 802-856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000146
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 7 Region: 752-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000578
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1356-1407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 9 Region: 695-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000414
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 10 Region: 223-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000343
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 11 Region: 862-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 12 Region: 997-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 13 Region: 1414-1464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000963
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 14 Region: 350-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000273
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 15 Region: 1462-1509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 16 Region: 948-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 17 Region: 904-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 18 Region: 422-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 19 Region: 30-110
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000189
Family APC10-like 0.057
Further Details:      
 
Domain Number 20 Region: 658-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family EGF-type module 0.076
Further Details:      
 
Domain Number 21 Region: 280-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000027440
Domain Number - Region: 1313-1338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00254
Family Laminin-type module 0.056
Further Details:      
 
Domain Number - Region: 1043-1103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Laminin-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027440   Gene: ENSCAFG00000018597   Transcript: ENSCAFT00000029520
Sequence length 3034
Comment pep:novel chromosome:CanFam3.1:7:73307183:73438713:-1 gene:ENSCAFG00000018597 transcript:ENSCAFT00000029520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCKLVEHVPGRPVRNAQCRICDANSANPKERHPISNAIDGTNNWWQSPSIQNGREYHWV
TITLDLRQVFQVAYVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDTECLTRYNITP
RRGPPTYRADDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLR
LQRIRTLNADLMTLSHRDPIDLDPIVTRRYYYSIKDISIGGMCICYGHASSCPWDETTKK
LQCQCEHNTCGESCSRCCPGYHQQPWRPGTVSAGNTCEKCNCHNKAQDCYYDESVANQRR
SLNTAGQFRGGGVCINCLQNTVGINCETCIDGYYRPHKVSPYEDNPCRPCDCDPFGSLSS
VCIKDELQSGLHKGKQPGQCPCKEGYAGEKCDRCQFGYKAYPACIRCECSRAGSVNEDPC
SEPCLCKENVEGDNCDLCKPGFYNLKERNPEGCSECFCFGVSDVCDSLSWSLSQVKDMSG
WLVTDLISSSKIRSQQDALGGRHQISINNSVVMQRLTSKYYWSAPEAYLGNKLTAFGGFL
KYTVSYDIPVETVDGDPMSYADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFRD
FNNKREIDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDTASPNVIDLALATEVE
HCECPQGYAGISCESCLPGYYRVDGILFGGICQPCECHGHAAECDIHGVCSVCKHNTTGD
HCEQCAPGFYGLPSRGTPGDCQRCACPLSTTSNNFSPTCHLEAGDEVVCDQCAPGYSGSW
CERCADGYYGNPTVPGESCVPCNCSGNVDPFEAGHCDSVTGECLKCIGNTDGAHCERCAD
GFYGDAVTAKNCRACECHGKGSISDVCHLDTGLCDCKPHVTGQQCDQCLPGYYGLDTGLG
CLPCNCSASGSMSDDCTEDGQCHCLPGVAGEKCDRCARGFYAYQDGGCTPCDCAHTQHTC
DPESGACICPPHTRGATCDQCEDGYWGHDLELGCQACNCSAVGSASHGCDALTGHCPCKP
AFGGLSCHQCSLGYRDFPDCVACDCDLRGTLADTCDEEQGLCSCAEDTGTCSCKENVLGL
QCSECRAGTYALHADDPLGCIPCFCFGLSQACSELEGYVRMPVTLDPEQPLLRVVSQSNL
KGTTEGVYYQAPDVLLDAVTVRQYVHAEPFYWRLPEQFQGDQLLAYGGRLKYSVAFYSSD
GIGTFNLEPQVLIKGGRTRKQVIYVDVPAPENGIRQEQQVGMKENFWKYFNSVSEKPVTR
SDFMSVLSNIEYILIKASYGQGLQQSRISNISMEVGRKAGELHPGREVASLLEKCLCPPG
TAGFSCQDCAPGYHRGKLPQGGSRGPRPLLAPCVPCNCNNHSDACDPETGKCLNCSHSTT
GEHCDVCAPGYYGKVTGSASDCSPCACPRSHPASFSPTCVLEGDADFRCDACVLGYEGQY
CERCSSGYHGNPRALGGTCQRCDCSPSGSVHGDCDRGSGQCVCRPGATGLRCEQCEPRHI
LLESDCVSCDDECVGVLLNDLGNVGDTILSVNLTGVIPVPYGILSNLENTTKHLREALLK
ENPQKELARDQLEDVAEQTDNLLRELTSVLTRSQNVTRMTERILKKSQDLMTFTEKLQMN
IQEIIEKAATLNQTLDEDFQQPSSTLQNMQKNITSLLEIIQKRQFTQLHQNAVLELKAAE
DLLLQIQKNCQEPQRELEVLKAAASSLLSKHNSELQAAGDLVREAEVKTQESNRLVHLAQ
ANLQEFNDKKLRVQEEQNLTLMLIARGRRLLDAVTTHSEVARDALAQLERHRDELLLWTA
KIRHHVDDLVMQMSKRRVLDLVYRAEDHAAELQRLAGALVSGLGSVRHVSLNATSATHVH
SNIRSLIEESEKVAEDALKTVTTASLFSESLVSNGKVALQRSSRFLKEGNSLSRKHQGIT
LKLNELKNTANRFQEDVDTITRQTNESLLLLRAIPGGVRDKGTRIKELAISVNQSAANTL
KNVVGLSQKLLNTSTDLSRVNATLQETNQLLQDSSMTTLLARRRVKDAETQASLLFDRLK
PLKILEENLNRNLSEIKLLINQARKQAASIKVAVSADRDCIRAYQPPISSTNYNTLTLNV
KTSEPDNLLFYLGSSTSADFMAVEMRRGKVAFLWDMGSGSTRLEFPDFPIDDNRWHSIYV
TRFGNIGSLSVKEMSAIEKPPMKTSKSPGAANVLDINNSTLMFVGGLGGQIKKSPAVKVT
HFKGCMGEAFLNGQSIGLWNYIEREGRCHGCFGSPQNEDSSFHFDGSGYSVVEKTLRVTV
TQIIMLFSTFSPNGLLLYLASNGTKDFLSIELVRGRVRVVVDLGSGPLALITDRRYNNGT
WYKIAFQRNRKQGFLAVIDAYNTSYKETKQGETPGASSDLNRLDKDPIYVGGLPRSRIVR
KGVTSKSYVGCIKNLEISRSTFDLLRHSYGVRKGCILEPIRSVSFLKGGYIELSPKSLSP
ESELLATFATKNSSGIILAALGRHGEKQGHLQAHGQPSQPFFSIMLIDGHVEVHVNSGDG
TSLRRALLRAPKGTYSDGQEHSISLIRTRRVITVQMDETNPVEMKLVPSAESRAINVSNL
YVGGIPEGEGTSVLKMRKSFHGCIKNLIFNMEHLDFTHVADYEQVDLDTCLLSERPKLAL
HKEDTELPPEPQPLPSLGQCAVDRAPEYIPNAHQFGLMQGSHFVLPFNQLAVRKRLSVQL
SIRTFASSGLIYYMAHQNQVDYATLQLHGGYLHFMFDLGKGRTKVSHPAPISDGKWHTVK
TEHFKRKGFMTVDGQESPTVITVGDGTMLDVEGKLYLGGLPSEYKARNIGNITHSVPACI
GEVTVNGKQLDKDSPVSAFAVTRCYAVAQEGTFFEGSGYAALVKEGYKVGSDVNITLEFR
TTSENGVLLGISSAKVDAIGLEIVNGKILFHVNNGAGRITAIYKPKAITTLCDGKWHTLQ
AQKSKHRLVLIVDGDAVRAESPHTQSTSADTIDPIYVGGYPADIKQNCLSSQTSFRGCLR
KLTLIKDSHVQSYDFSRAFDLQGVFPHSCPGSEP
Download sequence
Identical sequences F1PJ02
ENSCAFP00000027440 ENSCAFP00000027440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]