SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027451 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027451
Domain Number 1 Region: 8-101
Classification Level Classification E-value
Superfamily SH2 domain 7.67e-22
Family SH2 domain 0.00072
Further Details:      
 
Domain Number 2 Region: 287-448
Classification Level Classification E-value
Superfamily Ras GEF 0.00000000000000379
Family Ras GEF 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027451   Gene: ENSCAFG00000018602   Transcript: ENSCAFT00000029533
Sequence length 576
Comment pep:novel chromosome:CanFam3.1:20:53536618:53543165:1 gene:ENSCAFG00000018602 transcript:ENSCAFT00000029533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVPQDGEDFASQPWYHGPLSRQKAEALLQQDGDFLVRASRSRGGHPVISCRWQGSALHF
EVLRVALRPRPGRPTALFQLEDERFPSLPSLVLSYVTGQRPLSQATGAVASRPVIRQGPI
RRSFSEDTLLESPARIELPRARKRSDSQPAGLEHMGLSGEDHSGPGASPVPTCALPRMGS
DPVLLKTPASLGSVVDGLRASDGQLHAKAPNKPPRTPSLVLHDASGRPPTYCELVPRVPS
AQETPTGHSGPETEASWWEANEEEEEEDRSFARPKAEVFFCPPNNLFCLLGPQNRPLEPK
VLSTLRDLFLEHHPGSTALHLLLVDCQATGLLGVTKAQRGAMGVTSGLELLTLPHGHRLR
LELLERHEALALAGALAVLGCSGPLEERAATLRGLVELALALRPGAAGDLPGLAAVMGAL
LMPQVSRLERTWRQLRRSHTQAALAFEQELKPLMRALDEGAGPCAPGEVALPHVVPAVRL
LEGQELPGPLDESCERLLRTLHRARLVARDAPQFREAAARRLRGFQPNPQLREALTTGFV
QRLLWGSQGVGAPHATRLEKFQRVLSALSQRLEPDV
Download sequence
Identical sequences E2RGR2
XP_542135.2.84170 ENSCAFP00000027451 ENSCAFP00000027451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]