SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027775 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027775
Domain Number 1 Region: 185-326
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-39
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 85-187
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-27
Family Second domain of FERM 0.00012
Further Details:      
 
Domain Number 3 Region: 9-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-18
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027775   Gene: ENSCAFG00000018829   Transcript: ENSCAFT00000029887
Sequence length 710
Comment pep:novel chromosome:CanFam3.1:X:103028814:103053554:-1 gene:ENSCAFG00000018829 transcript:ENSCAFT00000029887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFHVRATDMQESLRGFVMSQKSSGKALFNLSCGHLNLAEKEYFGLEFCSHSGNNVWLELL
KPITKQVKNPKDVVFEFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSENCTAL
MVSHILQSELGDFHEETAKKHLAQTRYLPNQDCLESKIMQFHQKHTGRSPAESDILLLDI
ARKLDMYGIRPHPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFR
YSGRTQRQLLEYGKKGRLRSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGG
GYYRNVNGVHASEPVLDSRRRNSAVEVTFAAELECSKPEVDPTLLHQSQSSSSFPFIYTD
PVFSTDPDPRDYFGERSPLSSFQPSSKFADNLMSTSSGLASKVSPARQLTYTDVPYIPCT
GQQVDIMPPQVFFYVDRPPQVPRRSPIMAEENDRPDSCLESTIMKPAKRSPRNVRMKSFQ
QDFQELQEAMARTTGRSNINVDLEVEEPNSEGAFAYSIQEQTPKRSQSQSDMKTIRFPFG
SEYRPLGPCPTLSRKADLFTYMFAEQGFPTVLTDQGAAERYIGSESSDSESEILKPDYYS
LYGKGTRSPMARIRLSSGSLQLDEEDEGVSFNTPTAEDRTLLKPCNYFVA
Download sequence
Identical sequences F1PPL7
ENSCAFP00000027775 ENSCAFP00000027775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]