SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029535 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029535
Domain Number 1 Region: 250-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-84
Family Protein kinases, catalytic subunit 0.000000000117
Further Details:      
 
Domain Number 2 Region: 141-281
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-37
Family SH2 domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 81-166
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-20
Family SH3-domain 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029535   Gene: ENSCAFG00000019938   Transcript: ENSCAFT00000031723
Sequence length 1150
Comment pep:novel chromosome:CanFam3.1:9:53120449:53261307:-1 gene:ENSCAFG00000019938 transcript:ENSCAFT00000031723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKKGVRGVAST
LLQAPELPTKTRTSRRAAEHKDPTDVPETPHTKGPGETDPLDHEPPVSPLLPRKERGPQD
SSLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERKAAVEEEGRET
SNGVPALTTLDAAEPAKSPKPSSGAGVPNGAFRESGGPGFRSPHLWKKSSTLTSSRLTAN
EEESGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRASENRSDQVTRGTVTPPPRLVKKTEDAADEVFRDMGESSPGSSPPSLTPKLLRKQ
VSGAPSSSLPHKDEAGKSSALGTPTTAELGTPASRGGPGMSGGASKAPAEEPRARRHKPS
SESPGRDKGKLSKLKPVPPPPLPASIGKAGKPSQSLSQEAAGEASTGGKAKAAAVVVDAV
NSDTVKPGLLGEGVKKPVLPSMPKPQSSGKPAGTPASPASAPSTLSSASSALAVDQPAST
AFIPLISTRVSLRKTRQPPERIASGTITKGVVLDGTEALCLAISKNSEQMASHSAVLEAG
KNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSS
VKEISDIVQR
Download sequence
Identical sequences F1PEX6
XP_548413.3.84170 ENSCAFP00000029535 ENSCAFP00000029535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]