SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030345 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030345
Domain Number 1 Region: 69-315
Classification Level Classification E-value
Superfamily RNI-like 1.18e-18
Family Cyclin A/CDK2-associated p19, Skp2 0.072
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily F-box domain 3.14e-17
Family F-box domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030345   Gene: ENSCAFG00000023016   Transcript: ENSCAFT00000035122
Sequence length 326
Comment pep:novel chromosome:CanFam3.1:20:51183016:51187651:1 gene:ENSCAFG00000023016 transcript:ENSCAFT00000035122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLADLPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMW
HLLRRYMASRLYSLRMGGYLFSGSQAPQLSPALMRALGQKCPNLKRLCLHVADLSMVPIT
SLPCTLRTLELHSCEISMAWLLKEQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFHALRS
LVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGL
SAPGLSVLEGMPALESLCLLGPLITPEMPSPAEILSSCLTMPKLRVLELQGLGWEGQEAE
RILCKGLPHCMVIVRACPKESMDWWM
Download sequence
Identical sequences E2R910
XP_542082.3.84170 ENSCAFP00000030345 9615.ENSCAFP00000030345 ENSCAFP00000030345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]