SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030750 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030750
Domain Number 1 Region: 43-108
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000972
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030750   Gene: ENSCAFG00000023177   Transcript: ENSCAFT00000035485
Sequence length 251
Comment pep:novel chromosome:CanFam3.1:5:56291061:56292359:-1 gene:ENSCAFG00000023177 transcript:ENSCAFT00000035485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQSGVQAVQTALPDSRCGTAMSAPSRTSPTAPAPRSPSTPGSEKVASPLECSICFSGYDN
IFKTPKELSCTHVFCLECLARLAAAQPTGRPGGEAVPCPFCRQPTAVPAAGAPALRTSHQ
LQARMPAHLRREEPVWLEGTKLCCCLPPSVPGLGEPGIVCVDVGLSKPAEPTAPTPAPGP
ARRQGRLARCWARCRDWRRVALVTALLLVLFCVVLWPVQCALKTGNLHCLPRPSTTITTA
TAFSSRPLADN
Download sequence
Identical sequences F1PXN1
ENSCAFP00000030750 ENSCAFP00000030750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]