SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000032366 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000032366
Domain Number 1 Region: 45-145
Classification Level Classification E-value
Superfamily Cyclin-like 2.51e-23
Family Cyclin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000032366   Gene: ENSCAFG00000023864   Transcript: ENSCAFT00000036933
Sequence length 252
Comment pep:novel chromosome:CanFam3.1:11:21050176:21054922:1 gene:ENSCAFG00000023864 transcript:ENSCAFT00000036933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDRGGPLDERRLVAHLQLALGREARLWRGGHPQHPALPGQVEIRHTVRELVLWLLEVKNI
FHFSQTTFNLALTTFSRLLVSLKMRERILQCVMITSLRLAAKVNEEEELIPRVKDFLKHY
GSGYSPNELLRMELAILDKLHWDLYIGTPLDFLTIFHALLVLGWPHVVELLPQRNPSLHV
ASLTRQLQHCMAGHQLLQFKGSTLALVIITLELERLMPDWCTPISDLLKKAQVSTEQLSH
CKELVEQHLRSL
Download sequence
Identical sequences F1PNJ2
ENSCAFP00000032366 ENSCAFP00000032366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]