SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000033076 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000033076
Domain Number 1 Region: 97-275
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.57e-74
Family F-box associated region, FBA 0.00000854
Further Details:      
 
Domain Number 2 Region: 14-93
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000127
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000033076   Gene: ENSCAFG00000024310   Transcript: ENSCAFT00000037544
Sequence length 279
Comment pep:novel chromosome:CanFam3.1:1:114120541:114127636:1 gene:ENSCAFG00000024310 transcript:ENSCAFT00000037544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASASRGRPARVPAPEPDPEEALDLSQLPPELLLVVLSHVPPRTLLGCCRRVCRGWRAL
VDGQALWLLILARDHGALLPLARSCLPPARDGGPCLLGRFCERRPIGRNLIRNPCGQEGL
RKWMVQHGGDGWVVEVNRSTVPGAPSQTCFVSSFSWCRKKQVLDLEEEGLWPELLDSGKI
EICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAMPVPIQQWNNNVCFQVTHVFSNL
KMGVRFVSFEHWGQDTQFWAGHYGARVTNSSVVVRARLS
Download sequence
Identical sequences E2RR90
XP_541629.3.84170 ENSCAFP00000033076 ENSCAFP00000033076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]