SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000034798 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000034798
Domain Number 1 Region: 746-769,989-1046
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000285
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1374-1486
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000196
Family Second domain of FERM 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000034798
Domain Number - Region: 1148-1282,1318-1330
Classification Level Classification E-value
Superfamily ARM repeat 0.00987
Family HEAT repeat 0.075
Further Details:      
 
Domain Number - Region: 1311-1368
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0413
Family Ras-binding domain, RBD 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000034798   Gene: ENSCAFG00000004837   Transcript: ENSCAFT00000039000
Sequence length 1588
Comment pep:novel chromosome:CanFam3.1:9:4937670:4954545:-1 gene:ENSCAFG00000004837 transcript:ENSCAFT00000039000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGCLEIPAELAVMLKTAEGRQQALAESITESMPPEVPARPHLTLPPDINQFLFSSFIS
TNFLDPVLPSPGQPLAKPLTRLDGENPQHALDINKVMLRLLGDGSLAPWQEQTMGEYLVR
QGQRWPGLRDEIFSQLVAQIWHNPDEQQSQRSWALMAILLSAFPPMPTLQKPLLKFVSDQ
APRGMAALCQHKLLGAMEQTYLAPRMARAHPPTQLEWTAGWRRGRMALDIFTFNEECYSA
EVESWTTGEQFAGWILQSRGLELPPRGWSVSLHSGDSWQDLAGCDFVLDLIGQTEDPGDP
ISPHSYPIAPHGLAEDIPPAPGIQAPSLPPGPPPAPTLPSRSYSGESRGSGNLDGFLDHL
FQPVLSPSHSDLEQGWALSSRMKGGGAIGPMQQGSYPMVYPGMVQMPGYQPAMMPAPMPM
MPAMGAVPAMPAMVVPPQPQPQPQPQPLLPSVDQRQLAIQQQNFINQQALILAQQMTAQA
MTLSLEQQTQQRRHQAQTQAQAQAQAQTPGAASPNSPPAVAPKPKKPMAPQEEPEHEPES
EISQEAQENPWQSKSFRQKQDFFQKMGQQQIKVKTVKPPPKIQIPQAEEQDEEEQDEEET
RAEPSPPPPPIVKKPVTQSKAKAAQEAEAKPAARKAEPADAPKPESRQRAEPSREIRNII
RMYQSRPGPVPVPVQPSRKPSKMFLKKNNPKDEALAKLGISNTHVPMSMPSPSPGKGPPP
AVAPRPKVPPQLGPSTSIKEKLDPFGQTPPSAQAPPPPPAPPLPPPEAPDTLSPGPRGLM
EPMEDQGVSTQLLPPSGSVCFSYVSTSWKLFLRKEVFYPRENFSHPYCLRLLCEQILKDT
FAKSCIRITEDERSKMKNLLEDLEVGLDSLDTTEDNVKKRIVVAARDNWANYFSRIFPVS
GESSSDVQLLGVSHRGLRLLKVTKVPSFHLNQLKTLCSYSYAELLGIECRGSSTLELSLK
SEQLVLHTARASTIKAMVELFLRELRKDSGYVVALRSYITDDHSLLSFHRGDLIKLLPVA
TLEPGWQFGSTGSRSGLFPADLVQPAAAPDFSFSPERSGRHQSQLQSREPGLAPWDGAVE
RHVRPRSQAHSEDSIAYASLSTDSHSYTMQEFALCHFRKPQALLDQTDGLAKDMAMASLV
QYTKAPIKESLISLSDEDTNKQAVESFRVLMQFMGDQPKPRGKNDLELLYELLKLCREEN
LRDEIYCQVIKQVTCHPQPEHCTRGWNLLSLLTGCFSPSATLMPYVIKFLQNSGSSQELA
RNSQEHLQRTVKYGGRQRLPSLGEIQAFLKGQGMRSLLIHLPGGVDYRTTIQTFTVAAEV
VEELCRQMGITDPQEMQEFALFLIKKEGELVRPLLPHEYLNSVVEQDTSLHSRRLIWETP
LHFDNPTYITTHYKQVLRDYLQGKLLVNPQADTQLARLAALQHRSQDQEDYLEQDMLNYL
PKPLRGHVNIPIIKKLIDQELRQLQVYNSQEAQISFIEAVSQLPLFGYTVYVVLRVSQMA
LPGPSLLGLNHQHLIVMDPCSQKQCCSITLKDLHRLHLLSPLESEGPPGLELNYGSADNP
QTIWFELLKAQELMHTIVFLTDRGLPSK
Download sequence
Identical sequences F1PSZ1
ENSCAFP00000034798 ENSCAFP00000034798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]