SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037771 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037771
Domain Number 1 Region: 199-348
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.05e-23
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.02e-21
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037771   Gene: ENSCAFG00000004728   Transcript: ENSCAFT00000046197
Sequence length 1024
Comment pep:novel chromosome:CanFam3.1:2:22639001:22856678:1 gene:ENSCAFG00000004728 transcript:ENSCAFT00000046197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWL
QLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIDVDS
EVVFELASYILQEAKGDFSSNEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLN
GQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIF
QWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQH
QFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQ
ESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELTGKLPVEYPLDPGEEP
PIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQ
RKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLIIADGNIASEDSSLSDALVLEDED
SQVTSTLSPLQSPHKGLPPRPPSHNRPPPPQSLEGLRQMHYPRNDYDKSPIKPKMWSESS
LDEPYEKVKKRSSHGHSSSHKRFPSTGSCAEAGGGSSSLQNSPIRSLPHWNSQSSMPSTP
DLRVRSPHYVHSTRSVDLSPTRLHSLALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRT
RSSNGSDPMDDCSSCTSHSSSEHYYPAQMNANYSTLAEDSPSKARARQRQRQRAAGALGA
ANSGSMPNLAARGAGGGVYLHSQSQPSSQYRIKEYPLYVEGGATPVVVRSLESDQEGHYS
VKAQFKTSSSYTAGGLFRESWRGGDEGDPGRLTPSRSQILRTPSLGREAAHDKGRAAVSD
ELRQWYQRSAAAHREHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSAA
LPQSQRSSTPSSEIGATPPSSPHHILTWQTGSCTDSCFLDASLYPELADVQWYGQEKAKP
GTLV
Download sequence
Identical sequences J9NWW0
ENSCAFP00000037771 ENSCAFP00000037771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]