SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038474 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038474
Domain Number 1 Region: 29-163
Classification Level Classification E-value
Superfamily Cyclin-like 2.38e-36
Family Cyclin 0.00011
Further Details:      
 
Domain Number 2 Region: 167-279
Classification Level Classification E-value
Superfamily Cyclin-like 2.24e-31
Family Cyclin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038474   Gene: ENSCAFG00000006939   Transcript: ENSCAFT00000011140
Sequence length 293
Comment pep:novel chromosome:CanFam3.1:25:13443296:13444193:-1 gene:ENSCAFG00000006939 transcript:ENSCAFT00000011140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLNHSIYCQAFSDALLCKTEDIDNEDWESLQLCSDYVKDIYQYLRQLEVLQSINPHFLD
GREINRCMRAILVGWLVQVHSKFRLLQETLYVHRHHGPSFTGLAVSRRKLQAVGITALLL
ASKYEEMFSPNIEDFIYITDNAYTSSQIQEMETLILKELKFELGFATLHFLKQASKAGEV
DVEQHTLAKYLTELTLIDYDMVHYHPSKVAAAASCLSQKILGQGKWNLEQQYYTGYTENE
LFKHMAKNVVKVNENLMKFIKNKYVSSKLLKISTIPQLNSKANQELASPLMGP
Download sequence
Identical sequences J9NYV4
ENSCAFP00000038474 ENSCAFP00000038474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]