SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039644 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039644
Domain Number 1 Region: 33-213
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.31e-49
Family CRAL/TRIO domain 0.000000012
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000039644
Domain Number - Region: 9-27
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0863
Family CRAL/TRIO N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039644   Gene: ENSCAFG00000028514   Transcript: ENSCAFT00000045622
Sequence length 219
Comment pep:known chromosome:CanFam3.1:29:13179614:13201883:-1 gene:ENSCAFG00000028514 transcript:ENSCAFT00000045622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVKAPSRSELLKNYYKWRAECPEISADLCPRSILGLLKAGYLGVLRARDPTGSKVLIYRI
AQWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAVFDLEGWQFSHAFQITPSVAKKI
AAVLTDSFPLKVRGIHLINEPIIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPD
ILPLEYGGAEFSMEDICQEWTNFIMKSENYLSSISQISE
Download sequence
Identical sequences J9P268
ENSCAFP00000039644 ENSCAFP00000039644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]