SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039978 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039978
Domain Number 1 Region: 872-1145
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-68
Family Protein kinases, catalytic subunit 0.00000822
Further Details:      
 
Domain Number 2 Region: 564-848
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-48
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 3 Region: 421-545
Classification Level Classification E-value
Superfamily SH2 domain 1.65e-16
Family SH2 domain 0.0024
Further Details:      
 
Domain Number 4 Region: 147-280
Classification Level Classification E-value
Superfamily Second domain of FERM 7.11e-16
Family Second domain of FERM 0.0039
Further Details:      
 
Domain Number 5 Region: 365-425
Classification Level Classification E-value
Superfamily PH domain-like 0.00000111
Family Third domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039978   Gene: ENSCAFG00000018615   Transcript: ENSCAFT00000049356
Sequence length 1152
Comment pep:novel chromosome:CanFam3.1:5:45328692:45405980:1 gene:ENSCAFG00000018615 transcript:ENSCAFT00000049356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHPNDSGNILYYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEMLGGQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQGEHLGRGTRTHIYSGT
LVDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPHCPEEVYQLMRKCWEFQPSNRTT
FQNLIEGFEALL
Download sequence
Identical sequences F1PIY7
ENSCAFP00000039978 ENSCAFP00000027467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]