SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040626 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040626
Domain Number 1 Region: 719-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000363
Family Laminin-type module 0.0004
Further Details:      
 
Domain Number 2 Region: 179-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000126
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 3 Region: 775-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000181
Family Laminin-type module 0.00091
Further Details:      
 
Domain Number 4 Region: 235-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 826-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000212
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 6 Region: 616-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 7 Region: 291-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 338-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 664-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000352
Family Laminin-type module 0.00045
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000040626
Domain Number - Region: 576-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00212
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 6-71
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00425
Family CBM4/9 0.091
Further Details:      
 
Domain Number - Region: 874-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family Laminin-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040626   Gene: ENSCAFG00000019927   Transcript: ENSCAFT00000043255
Sequence length 1496
Comment pep:novel chromosome:CanFam3.1:9:52970271:53028896:-1 gene:ENSCAFG00000019927 transcript:ENSCAFT00000043255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFHSQDDSTWWQSPSMALGVQHPTSVNITLRLGKAYEITYVRLKFHTSRPESFAIYKRTR
AGGPWEPYQYYSASCQKTYGRPEGQYLRPGDDERVAFCTSEFSDISPLSGGNVAFSTLEG
RPSAYNFEESPVLQEWVTSTELLISLDRLNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCK
CNGHASECSPDGAGRLACRCQHNTTGTDCERCLPFFQDRPWGRGTAEAANECVPCNCSGH
SEECVFDRELFRSTGHGGRCLRCRDHTAGPHCERCQEDFYRWSPRTPCQPCDCHPAGSLR
LQCDASGTCICKPTVTGWKCDRCLPGFHSLSEGGCRPCSCSHAGSLGTCDPHSGRCPCKE
NVEGHVCDRCRPGTFNLQPHNPAGCTSCFCYGHSKVCEAAAQFREHHIISDLRQGAKGWR
TGSVGGPEHPAQWGPRGLLLNPEDEEELTLPEKFLGDQRFSYGQPLTLTFLVPPGASPLP
VQLRLEGAGLALTLQHSSLSSSLDAEQPGEVQLRFELQETSEDVDPPLPPFHFQRLLTNL
TALRIRTSGQSPSPSGQVFLTEVRLTSAQRGLSPTASWVETCSCPKGYTGQFCESCAPGY
KREIPLGGPYTNCVPCTCNQHGTCDPHTGICVCDHHTEGPSCERCLPGFYGNPFAGQPDD
CQPCPCPGQSACIAVPESSDVVCTHCPLGQRGRRCEICDDGYFGDPLGISGAPEPCRPCQ
CSGNVDPNAVGNCDSQSGHCLRCLHNTTGAHCERCQDGFYGSALAPRPADRCTPCNCHPE
GSVSEQRPCDPVTGQCTCLPHVMGRDCDRCSPSFYDLQPGRGCRSCKCHPLGSQEDQCHP
KTGQCPCRPGVEGQACDRCQLGFFGFSIKGCRACRCSPLGAASPQCHKNSTCVCRPGFVG
YKCDHCQDNFFLTAGGTHCQECPSCYSLVKEEAAKLKARLTLMEGWLEGTNCGRSWGPLP
ILQGEAPRGDIYQDYHLLQGAWEVFLEQVTGLKDAVKAAREQLRALSRGASCAQAQTEKT
CIQLADLDTVLESSEEEILQAATVLKSLVIPQNGPSQPTTWSHLATEARALARSHKDATA
KIKATARRALVASNTSYALLWSLVEGRMALEAQRELEDRYQDVQAAQKALGTAAAEVLPE
AEKALATVQRVGVDAAPRLALLAAPMALPQKSQAGALDLKVQALEKTVTSRERVVTEAAW
ALQATAQAMLHKTQPLMQVGSCPASLLSLQLRQEARAALTRASSSVQAATVTVMGARTLL
ADLEGMKRQFPQPKDPATLGRKAGSVRGRLLTDLKKKTKQAERMLGNAASVSASAKKKGQ
EAETLAKDSAKLAKALLREGKQEHRRAGRLSSQVQTTLRQASQQVLASGDRRQELEAAGQ
VGASLNAVEQQIWESRTSLEKDVKVLSELLARLGSLDTHQAPVQALNETQWALERLRLQL
SPPGALQGKLRLLEQESEQQELQIQSFENDLAEIRADKQNLEAILQSLPKSCASWQ
Download sequence
Identical sequences F1PFL6
ENSCAFP00000040626 ENSCAFP00000029518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]