SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041631 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041631
Domain Number 1 Region: 306-545
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.22e-74
Family STAT DNA-binding domain 0.00000144
Further Details:      
 
Domain Number 2 Region: 136-305
Classification Level Classification E-value
Superfamily STAT 1.35e-33
Family STAT 0.00049
Further Details:      
 
Domain Number 3 Region: 546-659
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-33
Family SH2 domain 0.0000364
Further Details:      
 
Domain Number 4 Region: 1-122
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.7e-27
Family Transcription factor STAT-4 N-domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041631   Gene: ENSCAFG00000017707   Transcript: ENSCAFT00000028085
Sequence length 825
Comment pep:novel chromosome:CanFam3.1:X:75563706:75566225:1 gene:ENSCAFG00000017707 transcript:ENSCAFT00000028085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLDNTFQDQLHQLYSDSLVDIRQHLAVWIEDQNWQEAALVNDDSKANMLFFY
FMDQLKYECGRCSQDPKCFLLQHNLQKFYRDIQALPQGPTQLAEMIFNLLLEEKRILTQA
QRAQLEEGDPALKTPDEIESWILELKAMMERLVKSISQLKNQQDVFCFWAQAKKFSLDSH
QMRQHQLQQETLNELDRRRKEVLDATKALLGRLTTPIELLLPKLEERKAQQQKACIGAPQ
EGGLEQLGKWFTAGAKLLFHLHQLLEELKGLNHLVSYQDDPLTAGVDLRKAQVMELLQRL
LHRAFVVETQPCMSQTPHRPLILKTGLVRLQEGNESLTAEVSIDKNPQSQGFQKFNILTS
NQKTLTPEKGQSQGLIWDFGYLTLVEQHSGGPGKGCNKGMLGVTEELHIISITVKYTYQG
LKEELKTDTLPVVIISNMNQVFIAWASVLWFNLLSSNSQNQQFFSSPPMAPWSLLGPALS
WQFSYVGRGLDPDQLNMLRNKLFGQNPRTEGALLSWANFTKRESPPGKLPFWTWLDKILE
LVHDHLKDLWNDGCIMGFVSWSKERRLLKKTISGTFLLRFSETSEGGITCSWVEHQDDDK
VLINSLQPFTKESLPLTKIIRHYQLLTEENIPENPLCFLYPVIPRDEAFGCYYQEKVNLE
ERRKYLKHRLILVSNRQVDELQQPLELKPEPEEESFELEMGLAPLPHLELEPLLAAGLDL
GPPLEPMLEPTLDVVPQGVSEPDLGPELRLEPLPDPASQAVPEPDLPHDLRHLNTEEMEI
FRNSMKIEEIMPNGDPLLVGQNTMDEAYIFHSSHFYTDGPLIPSD
Download sequence
Identical sequences J9P7J4
ENSCAFP00000041631 ENSCAFP00000041631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]