SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042293 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042293
Domain Number 1 Region: 26-152
Classification Level Classification E-value
Superfamily EF-hand 8.2e-37
Family Calmodulin-like 0.0000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042293   Gene: ENSCAFG00000018225   Transcript: ENSCAFT00000028955
Sequence length 173
Comment pep:novel chromosome:CanFam3.1:X:87083013:87083531:-1 gene:ENSCAFG00000018225 transcript:ENSCAFT00000028955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKRAKTKTTKKRPQRTTSNVFAMFDQSQIQGFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDQFTDEEVDELYREALIDKRGISITLSSHASLNTEQKTKMTE
Download sequence
Identical sequences J9P960
ENSCAFP00000042293 ENSCAFP00000042293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]