SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042963 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042963
Domain Number 1 Region: 519-607
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-19
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 332-426
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000235
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 3 Region: 222-273
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000072
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 412-452,483-518
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000113
Family Second domain of FERM 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042963   Gene: ENSCAFG00000014843   Transcript: ENSCAFT00000046782
Sequence length 630
Comment pep:known chromosome:CanFam3.1:8:29081077:29090359:-1 gene:ENSCAFG00000014843 transcript:ENSCAFT00000046782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKV
KVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLI
TPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPE
ILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRI
NQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALS
DLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKE
ESSGTPAHQMNLRGKESLGMSSVDGLKYKVIFLLKILATAFNFLFNRCDNEKQYAHWMAA
CRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPRYLKKY
KNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAY
NRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFI
GGYIFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences F1PFB4
ENSCAFP00000021879 ENSCAFP00000042963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]