SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000067 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000067
Domain Number 1 Region: 3-64,97-412
Classification Level Classification E-value
Superfamily Serpins 3.27e-128
Family Serpins 0.0000000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000067   Gene: ENSCAFG00000000059   Transcript: ENSCAFT00000000083
Sequence length 416
Comment pep:novel chromosome:CanFam3.1:1:13260225:13276808:-1 gene:ENSCAFG00000000059 transcript:ENSCAFT00000000083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELYVANTIFALNIFKHLANTTATPNLFFSPWSISSTIAMVYLGARGKTADQMAKVFQF
DKIGAPETPVTPENLTGCELMQQIQKSPYPEAISQAQAGAALHSAFSSLSAAVSAASGEY
LLESVNQLFGEKTARFKEEYMRLSKKYYSTEPQAVDFLECAEETRKKINSWVKTQTKGKI
PDLLPKGSVDGDTKMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNTTQRVPVQMMYLHADL
NIGYIGDLKTQILELPYAGNISMFLLLPDEITDVSTGLELLESEITYDKFIKWTSKDTMA
EDNVEVYLPQFKLEERYELRSILRNMGMEEAFSQSQANFSGMSNTNDLFLSQVFHQATVD
VNEEGTEAAAGTGATLSGRTGHGGPQFVADHPFLFLIMHKITKSILFFGRLVLPQN
Download sequence
Identical sequences E2R079
ENSCAFP00000000067 ENSCAFP00000000067 XP_851985.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]