SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000074 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000074
Domain Number 1 Region: 93-532
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.01e-78
Family Integrin alpha N-terminal domain 0.00000123
Further Details:      
 
Domain Number 2 Region: 862-1100
Classification Level Classification E-value
Superfamily Integrin domains 1.52e-50
Family Integrin domains 0.00082
Further Details:      
 
Domain Number 3 Region: 532-698
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-31
Family Integrin domains 0.0056
Further Details:      
 
Domain Number 4 Region: 699-853
Classification Level Classification E-value
Superfamily Integrin domains 3.92e-23
Family Integrin domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000074   Gene: ENSCAFG00000000060   Transcript: ENSCAFT00000000090
Sequence length 1196
Comment pep:novel chromosome:CanFam3.1:10:92221:110821:-1 gene:ENSCAFG00000000060 transcript:ENSCAFT00000000090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGVGGAGRPGGGRGVARRGTARPLQTCGTRDRRAAVGDLGLRHQRVFALVGSAPSVRRM
AGARGRGPWGPPGIRCLLGSLLAALLAPGAVAFNLDVTGALSKEGEPGSLFGFSVALHRQ
LQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDRGADVQKESKEN
QWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDVIGRCFVLSQDLAARDELDGGEW
KFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGLLFVTNIDSSDPDQLVY
KTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDS
ASRLVPEVMLSGERLTSGFGYSLAVADLNNDGWTDLVVGAPYFFERQEELGGAVYVYLNQ
GGHWAGVSPLRLCGSPDSMFGISLAVLGDLNQDGFADIAVGAPFDGDGKVFIYHGSSLGV
VVKPSQVLEGEAVGVKSFGYSLSGGLDVDGNHYPDLLVGSLADTAVLFRARPILQVSHEV
FIAPRTIDLEQPNCAAGHLVCVDLRVCFSYIATPSSYSPIVALDYVLDGDTDRRLRGQVP
RVTFLSRGPDDPKHQSSGTVWLKHQHDRVCGDTMFQLQENVKDKLRAIVVTLSYNLQTPR
LRRQAPGQGLPPVAPILNAHQSSTQRTEIHFLKQGCGEDKVCQSNLQLVQARFCARVSDS
EFQPLPMDADGTTALFALSGQPVIGLELTVTNLPSDPAQPQADGDDAHEAQLLVTLPASL
HYSGVRALDPAEKPLCVSNENASHVECELGNPMKRGAQVTFYLILSTSGITIETTELEVE
LLLATISEQDLHLISVRARVFIELPLSIAGVAVPQQLFFSGVVRGESAMKSERDIGSKVK
YEVTVSNQGQSLNTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPRRKGLCSPRPNI
LHLDVDSRDRRRRELEQPKQEEHPEHLEPSTSWWPVSSAEKKKNITLDCARGTANCVVFS
CPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVTVRANITVKSSIKNLVLRDASTVIP
VMVYLDPVAVVAEGVPWWVILLAVLAGLLVLALLVLLMWKMGFFKRARYPEATVPQYHAV
KIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGHPEPGSDGHPMSSTA
Download sequence
Identical sequences F1PIU6
ENSCAFP00000000074 ENSCAFP00000000074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]