SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001876 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001876
Domain Number 1 Region: 54-108,214-313
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-40
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 2 Region: 6-75,106-126
Classification Level Classification E-value
Superfamily EF-hand 0.0000000133
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001876   Gene: ENSCAFG00000001307   Transcript: ENSCAFT00000002028
Sequence length 631
Comment pep:novel chromosome:CanFam3.1:12:4463934:4483185:1 gene:ENSCAFG00000001307 transcript:ENSCAFT00000002028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDD
GPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRVDSNGNSMLSNEDAFR
LWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVGLGELEELLAQEAQAAQTTTGGL
SVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGLRRNWTERWFQL
QPSSLCYFGSEECKEKRGTIPLDAQCCVEVLPDREGKRCMFCVKTASRTYEMSASDTRQR
QEWTAAIQTAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERK
LQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEE
AARQRQRIQELEEMQQRLEEALHLEVKARRDEEAVRLAQTRLLEEEEEKLKQLLQLKEEQ
ERYIERAQQEKQELQQEMALQSRSLQQAQQQLEEVRQNRQRADEDVEAAQQKLRQASTNV
KHWNVQMNRLMHPIEPGDKRPTISSSFTGFQPHLLARRDSSLKRLTRWGSQGTRTPSPSS
SEQQKSLNGGDEAPISASAPQEDKLDPAPEN
Download sequence
Identical sequences E2R9X5
ENSCAFP00000001876 ENSCAFP00000001876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]