SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002095 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002095
Domain Number 1 Region: 204-347
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-38
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-31
Family Second domain of FERM 0.0000822
Further Details:      
 
Domain Number 3 Region: 18-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-26
Family First domain of FERM 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002095   Gene: ENSCAFG00000001446   Transcript: ENSCAFT00000002259
Sequence length 541
Comment pep:novel chromosome:CanFam3.1:1:75892940:76183278:1 gene:ENSCAFG00000001446 transcript:ENSCAFT00000002259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMIHFRSSCIKSLSQDMKCTIRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEKDYFG
IRFVDPEKQRHWLEPNKSISKQMKSHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKR
DIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYINEFEIFPKQSQKLERKIVEIH
KNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIH
LIKWPDVCKLKFEGKTFYVIGTQKEKKAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSS
QIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVHRANITQSRSSYSLNKQLI
INMEPLQPLLPSPSEQEEELPLGEGVPLPKEDISAPLISSSPVKEAREYESPPSEEEDKI
KEEPLTISELAYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDTDSFEELEADENAFLM
AEEEELKEAHQALSWSYDILSGHIRVNPLVKSFSRLLVVGLGLLFFVFPLLLLLLESVYM
Q
Download sequence
Identical sequences F1PHQ5
ENSCAFP00000002095 ENSCAFP00000002095 XP_541268.5.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]