SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003459 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003459
Domain Number 1 Region: 267-396
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 398-503
Classification Level Classification E-value
Superfamily PH domain-like 6.64e-24
Family Third domain of FERM 0.0067
Further Details:      
 
Domain Number 3 Region: 41-138
Classification Level Classification E-value
Superfamily PDZ domain-like 3.06e-16
Family PDZ domain 0.03
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000543
Family Ubiquitin-related 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003459   Gene: ENSCAFG00000002386   Transcript: ENSCAFT00000003740
Sequence length 1578
Comment pep:known chromosome:CanFam3.1:11:54003741:54052456:1 gene:ENSCAFG00000002386 transcript:ENSCAFT00000003740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVETSLFQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGPAGIPIQTITPVKHTVKI
DKDALLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNDEPAESLSCERAVNIL
REAEDPLSITVVRCTSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLVSGHSQGNSLLCMP
NVLKLYLENGQTKAFKFEANTTVKDIILTVKEKLSIRSMEYFALALEEQYNISRLHLLHE
EELIQQVVEREESHDYRCLFRVCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGKIFNATLMLQDRESYIALLVGA
KYGISQIISSKLNIMSTLAEFANISRVELTEESEKVSMVKVYLQDVKVLTLLLESNSAKD
LACLIAGYYRLFVDPDTSIFLWPGNKQQVHRVSAEEGYESRACSDSEESSEVDCVLEPLS
DGHVLKLGPCRPLVKEEQPPGDSPMPEMARRGPSTSGASSMTDSAESEASDSANTESRGC
RTSGSSESMDALEEDDLDTCSSSRSGFFHSNSPGFPETLGSSSQEERSRIETNGFLCLLD
LAQRANHPCQKTEFSESPTPETFSWGPEPSAVRLDPRLYEGSRTDYYSLCSSVSLASHLS
NSSESTASRQGRGLPAWGQKGWTEAQPSSALEALAPHLPLAFEDGSSDEEYYDAADKLTP
PDTLSGPRAVSAAEPSATNSQNKVSTCTLEDGLNPGPDGREPSRRGGVKKYAKTLRKRRS
FLQTDYTCQVSFPLVPSASLESVDDVCYYNREPYLALGAPSPTVSSLQDMHSEPGLLETK
ALGLLGPLRKPKSKNPASRVMEMEPETMETKSVIDSRVSSISAIRLCIDPDHKESSGDAP
LTATVASSPASTPHCSNPGSSGPDNSRAEPSQTLSPFQHSDGSAPKELTLELGDSTSSLS
STDPNPDRGCQAISPGPHNASQADTLELGGVQFETRSGSLFTNPMQETAPKCTEPLLSPP
LRPRSGEYGIYSEEKMASFPSEEEQQGQLSLVHDGEVTNKNGTDLFHDESWKDSGDSRGD
LSNAVLQTGVIAPAGAIIASLSLKSPVTGTEQILPHSPTDPKGQSRETPSQTCQAQEQKL
LEELDLDPDFLFGDQTIPSAFPLEEVKAEPLNHMIGKDTASRDTTQQICFNPGPSLPKPL
ACPQKEPHLEGSNHCSLSESKGKSPSICLPAEKSFLCFAPESHPKVSAGLRMATSLGFVG
ANETVAPRIGMEQCSCQFSYATCFRGLQPETEEEDRDLEAHPTAPLTSPPSAGSRLALPW
RPARTHSCSAEPLPRKSHIWPEYCSRALRQLKAAPASTPEGFIQLRESLLELQDILEASW
GNGNKHPPEKCTWHFSESRSRLCMGSQKLLSSCQHVIRMDQSPEEMQGAVRDTFQHLVQL
AGLCFQFTDCSRCSSRHREAAGNLRDVVYAYHQFVEAAKLTCERGYHDLSVKLLARRCTA
LTAAVFCLTQKFRASAAL
Download sequence
Identical sequences E2RHX5
ENSCAFP00000003459 XP_013973345.1.84170 ENSCAFP00000003459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]