SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004093 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004093
Domain Number 1 Region: 561-676
Classification Level Classification E-value
Superfamily SEA domain 9.42e-18
Family SEA domain 0.0061
Further Details:      
 
Domain Number 2 Region: 232-317
Classification Level Classification E-value
Superfamily SEA domain 0.00000000085
Family SEA domain 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000004093
Domain Number - Region: 682-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004093   Gene: ENSCAFG00000002768   Transcript: ENSCAFT00000004425
Sequence length 791
Comment pep:novel chromosome:CanFam3.1:12:37506703:37615194:-1 gene:ENSCAFG00000002768 transcript:ENSCAFT00000004425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHLSSHRCVGNGFNIWQFLKEINLSFTDVSIKIYHSETKDIDNAPRIETTESTPKMYKVS
TMKRIFDLAKHRTKRSTFFPTGVKVCPQESMKQILASLQAYYRLRVCQEVVWEAYRIFLD
RIPDPGEYQDWVSICQQETFCLFDIGKNFSNSQEHLDLLQQRLKQRHFPERKDEISTEET
LGEPDETPVFSTDVVSVSLGPFPLTLDDTLLNDTKMPTIESKAESTKISEGPLEQKVELS
ITLTNQRFKAELTDSQSPYYQELAEKSQLQQMQKVFKKLPGFKEIHVLGFRPKKRREGSS
SVETRVMAIFTRDSAEVKSPASDHLSFDSNKIESEGVPQGMMEEEKQPEIYLTALDLKKL
ISRALEEDKSLDVETIQFTDEFWGLLPGSDPDFHSVLPTLLTDNTKDATLSPELPLGQSG
FETLDKTGHSIPDSSWSPPAKASASLSDTLPFFTASSIFSLTGQSATDIMPVDQTVLIPG
RTIPSDDYSSISQSALEISRSTASLGSQDIVRDLDIMDLTNTPASSEVPRLSGYVSTPGL
FLENTTPTPALQYLTTSSMTTATKGQELVVFFSLRVANMPFSKNLFNKSSLEYQALEQQF
TQLLVPYLRSNLTGFKQLEILNFRNGSVIVNSKMRFAKSVPYNLTKAVKGVLEDFRSAAA
QQLDLEIDSYSLDIETADQADPCKFLACGEFAQCIKNEWTKEAECRCRPGYEDQGHLDHP
APGICAPIEECEVIQGKGAPCRSPGHSRNQAYKTRVKKFQQEQNNKIIRKRNSEVLTGGY
EEFNYQDGEGN
Download sequence
Identical sequences F1PX79
ENSCAFP00000004093 ENSCAFP00000004093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]