SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006313 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006313
Domain Number 1 Region: 1150-1345
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 940-1063
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-32
Family Pleckstrin-homology domain (PH domain) 0.000000503
Further Details:      
 
Domain Number 3 Region: 41-166
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006313   Gene: ENSCAFG00000004249   Transcript: ENSCAFT00000006820
Sequence length 1881
Comment pep:known chromosome:CanFam3.1:2:8798040:8876281:1 gene:ENSCAFG00000004249 transcript:ENSCAFT00000006820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATRRTGLPEGDGDKLKACGSPTCEISKTKDGKEQSETVSPSEDETFSWPGPKTVMLKR
TSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFE
AGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVAYSQDAYLKG
NEAYSGNARNIPEPPPICYPWLPSAPSAMAQPVEISPPDSSSNKQQTSTPVLTQPGRAYR
MEIQVPPSPTDVVKSNTAVCVCNESVRTVIVPSEKVVDLLTNRNNHTVPSHRTEEVRYGL
NEQTSLKTVSRTTSPSSSIPTAHLIHQTAGSRSLEPSGMLLKSTNYSGHSEGISSSRPQA
VDSPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQSTTDY
NQVVPNRSTLQVRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGALASSS
VSFSNHRTRSWDYIEGQGEPVENVNSESQIPDSNGERKQTYKWSGFTEQDDRRGIYERPR
QQEIHKSFRGSSFTVAPSVNSDNRRVTGRGVGSVSQFKKVPPDLKTLQPNRGFQTTCGMS
LPRGVSQDRSPLVKVRSNSLKAPSPHVTKPSFSQNSLVSVKDQRPVNHLHQNSLLNQQTW
LRTESAPDHQVEPGKAPSSSGTSGKSVPQTSENSGASDLEVLVPQRNQDLNLREAEIQEA
DTLDNRETVVLREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREVHIKRM
EERKASSTSPPGDSLASIPFIDEPTSPSIDHDLAHIPASAVISASTPQAPQAPQAPQAPQ
APSIAMVPPSLTTSAPLIRRQLSHDQESVGPPSLDAQPSSKTERSKSYDEGLDDYREDAK
LSFKHVSSLKGIKILDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLITDKGKRVGGS
IRPWKQMYVVLRGHSLYLYKDKREQMTPSEEEQPISVNACLIDISYSETKRKNVFRLTTS
DCECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKT
PRQSLSIRQTLLGAKSEPKTQSPHSPKEESERKLLTKDDTSPPKDKGTWRKGIPSIMRKT
FEKKPTATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISS
MQEELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLD
RLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNM
THMVTHMPDQYKIVETLIQHHDWFFTEEGVEEPLTTVQEENTVDSQPVPNIDHLLTNIGR
TGVSPGDVSDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKTQPSSSE
DELDNVFFKKESAEQGQSDIKEESKKESEALCRKQRAVISKEGNAKKDSGAAKEERKESA
ASGEASPPPPPPPSARARKSPCPGCRSPPPGESPRPPGAPRPTPPGDAGSDAGTRLGAPP
HAPLARPCPRKRSSPEAGGAASDRARASSAASLTGPGPDPDADPDADPDADPDADPGRLS
PEVRSVAESRGDEADDERSELVSEGRPVETDSESDFPVFPAAPAADRGPRGRPREAGRAS
RRSSEGSEPSGTDGSRTPSLDSRRQLFSSHKLIECDTLSRRKSARLRPDGGDRDAPALAR
VFDVMKKGRSTGSLLAPGRAEPDRQEPTWRTKLADRLKLRPRAPADDMFALGPQKAGEAA
KRKHIRRRHTLGGHRDAADLSADLSADLSAGLSAGERGERREPGERGERREPGPPARARA
RARPGSGSFRNASPDASPAAL
Download sequence
Identical sequences J9P9F1
ENSCAFP00000006313 ENSCAFP00000042384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]