SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006751 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006751
Domain Number 1 Region: 928-1149
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-39
Family DBL homology domain (DH-domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 1305-1506
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-33
Family Pleckstrin-homology domain (PH domain) 0.0000886
Further Details:      
 
Domain Number 3 Region: 1136-1253
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-23
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000006751
Domain Number - Region: 857-887,968-995
Classification Level Classification E-value
Superfamily EF-hand 0.0164
Family Calbindin D9K 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006751   Gene: ENSCAFG00000004521   Transcript: ENSCAFT00000007289
Sequence length 1508
Comment pep:novel chromosome:CanFam3.1:20:4906784:5027296:1 gene:ENSCAFG00000004521 transcript:ENSCAFT00000007289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRADSPKPPVAPKPKTTSPLTPMTTPKFTSSPRPDSLHSPNSMSRGPKPPIAPKPRLST
PSEWRASVYVINSLNKCSNGKLLCVDRGLYEEHRSNLECSESEADEDYIVVPKAPPKEDE
PRDSTSAENAVMISPAAGEEECQEGGEESDPEGMGAAEDLAAPAEGVISDEADGGTAPTP
EDVGVEDSACDLGAEEQTFTREEEEKLVEEHNMYNLEDGGPWDGEAILPSDVILTQVDLE
GPAIPSEEPGPPGTPREEGEGGEEGSPNTELGAPDECVGSDRPPEGDAEDASKELTKNEG
LASSIQEAERAIVNPEVSKEECEDTIASGDQDEPPDQNEKTDQEEMAAVTQEVGEDPREG
RDPVQDEPAEESCQIIPFENDGVDDFVTSLSGSPYEFFPTESTSFCSESYSSLSKSAGGL
ESQQEPQSAECAEQDPIVRASYGAGEGPSVPDVVVMTGDEDAGDDALTNPYEMGVDLDQG
TVPGEGEEPETQAASDTLSAYGTKEEMNSDAEGGLVPTDRKNIIARARPHSGKVAGYVPE
TVPEEIGPEAGSSAIGIKGATKEARKTVLSLEGKPLEASRALPAKPRAFTLYPRSFSVEG
REIPVSLYRESEASSLDDHRIKRKDDNLSLPCVIGSSGSFSQRNHLPSSGTSTPSSVVDI
PPPFDLACITKKPITKSSPSLLIETEPPDKYTKKKKSSFKKFLALTFKKKSENKVHVDVN
VSSSRSSSESSYHGPARLLEIDRRSLSNSPQLKARTGKLRASESPSSLIFYRDGKRKGVP
FSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIPAMNSDYENIQIPPRRP
ARAGTFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSTDQEAESAYTEPYKVCPIS
AAAPKEDLSSDEEQGSSEEEDSVLRDPSLTHKMEGQSRAHVIAQELLSSEKAYVEMLQHL
HLDFHGAVTRALDEIDQEGKDTLSREELRRGLSELPAIRDLHQGILEELGERLLHWEGQQ
KVADVFLAREQEFDHHAAHILQFDRYLSLLSETCLHSPRLAAAVREFEQSQQGGGQNVKH
RLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALTLISKVTDRANDSMEQGENLQKL
VHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKSRRPRHLFLMSDVLLYTYPQKDGKYRLK
NTLSVASMKVSRPVMEKVPYALKIETPQSCLTLSASSCAERDEWHSCLSRALPEDYKAQA
LAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRN
CSRNKYPLKYLKDRMAKVCDGCYGELKKRGGDVPGLMRERPVSMSFPLSSPRFSSSAFSS
VFHSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKKGKRHWKKLWFVIKGKVLYT
YMASEDTVAMESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYSFKAEDTNSAQRWIE
AMEDASVL
Download sequence
Identical sequences F1PLT6
ENSCAFP00000006751 XP_541754.3.84170 ENSCAFP00000006751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]