SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006923 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006923
Domain Number 1 Region: 234-320
Classification Level Classification E-value
Superfamily SH2 domain 3.05e-48
Family SH2 domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 11-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.71e-39
Family N-terminal domain of cbl (N-cbl) 0.00026
Further Details:      
 
Domain Number 3 Region: 326-403
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-37
Family RING finger domain, C3HC4 0.00017
Further Details:      
 
Domain Number 4 Region: 148-233
Classification Level Classification E-value
Superfamily EF-hand 7.48e-36
Family EF-hand modules in multidomain proteins 0.0000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006923   Gene: ENSCAFG00000004651   Transcript: ENSCAFT00000007480
Sequence length 497
Comment pep:novel chromosome:CanFam3.1:1:110590804:110606717:-1 gene:ENSCAFG00000004651 transcript:ENSCAFT00000007480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAPRRRRWEEARELRRAVRLLQRLEEQCGDPRLASGPPSLRDLLPRTAQLLRDVAH
ARQAAGGGGPEDPGGARDFLIVYVHNLEAKSRQVAALLPSRGDRGADDELFREGSRLRRQ
LAKLALIFSYMHAELGALFPKGEYCGHTYKLTKASAHNFWRRHCGARCMLPWAEFELLLC
TCHPVESGATALALRSTINLTCSGHVSIFEFDIFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQVRLQACRDKPGSYIFRPSCTRLGHWAIGYVSSDGSILQTIPLNKPLFQALLD
GQKEGFYLYPNGRSHNPDLTELYQMEPHQYIHVSEEQLQLYWAMNSTFELCKICAEGNKD
VKIKPCGHLLCSRCLAAWQNSDSQTCPFCRTEIKGHEAVSVHQIQVRPAEARAAAEDQRE
NRDQADGEEELGQVASSAPPQPPQLNVSAAKDWLKVVPPALPRLQGPIPLPRIKTVALAP
WQITSSPQAREGATGNS
Download sequence
Identical sequences E2RCK0
ENSCAFP00000006923 XP_005616520.1.84170 ENSCAFP00000006923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]