SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010037 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010037
Domain Number 1 Region: 518-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000135
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 44-71
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010037   Gene: ENSCAFG00000006733   Transcript: ENSCAFT00000010833
Sequence length 906
Comment pep:novel chromosome:CanFam3.1:25:11419126:11550685:-1 gene:ENSCAFG00000006733 transcript:ENSCAFT00000010833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAAGVKLKYCRYYAKDKTCFY
GEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVAAFPPGAVPGGGAGPPPGPKKPDLG
GPGAGATAGGGGSSGVLDGPRLAIPGIDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKY
PLMQRMTNSSSSPSLLNDSAKPYAGHDPLTSPASSLFNDFGALNISQRRKPRKYRLGMLE
ERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGST
SRLSNVSQSNMSAFSQVFSHPSMGSPAAAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRR
SHTPNPANYMVPSSASTPVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMRSFK
NYHRTACRTEGQIIEVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITM
AQIDQADMPAVPTEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLR
RIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSR
HFNDPNADAYFTKRKWGQHDGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVM
DPTKILITGKTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNS
LAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQ
MRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQ
VTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIA
AANGQL
Download sequence
Identical sequences J9PBG4
XP_005635562.1.84170 ENSCAFP00000010037 ENSCAFP00000043143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]