SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012002 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012002
Domain Number 1 Region: 372-472
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.14e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 104-169
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 188-242,270-289
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012002   Gene: ENSCAFG00000008095   Transcript: ENSCAFT00000012969
Sequence length 659
Comment pep:known chromosome:CanFam3.1:21:36293722:36323489:1 gene:ENSCAFG00000008095 transcript:ENSCAFT00000012969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGPTDLLSSPLGTSGMDCNRKRKGSSTDYQLDDFSFDGEPSKA
RFVLLRSSQVEFGEHSDRRESMDTDKDDPHGRLDYTEHQGRIKNAREAHSQIEKRRRDKM
NSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELK
HLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQL
SSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPST
CSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDSEPDNEGCNLSCLVAIGRLHSHVVPQP
VNGDIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAEC
HRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEG
GDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHR
IRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLPGQAQENPGYPYSS
DSSSILGENPHIGIDMIENDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences J9NTT7
ENSCAFP00000036573 ENSCAFP00000012002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]