SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013230 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013230
Domain Number 1 Region: 640-855
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-107
Family Thrombospondin C-terminal domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 513-638
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.2e-34
Family TSP type-3 repeat 0.00000541
Further Details:      
 
Domain Number 3 Region: 126-171
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.22e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00096
Further Details:      
 
Domain Number 4 Region: 444-515
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.32e-16
Family TSP type-3 repeat 0.00021
Further Details:      
 
Domain Number 5 Region: 373-442
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000222
Family TSP type-3 repeat 0.00061
Further Details:      
 
Domain Number 6 Region: 284-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000178
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 231-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000118
Family EGF-type module 0.02
Further Details:      
 
Domain Number 8 Region: 8-64
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000105
Family Laminin G-like module 0.049
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000013230
Domain Number - Region: 200-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000389
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 334-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00528
Family EGF-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013230   Gene: ENSCAFG00000008975   Transcript: ENSCAFT00000014307
Sequence length 873
Comment pep:known chromosome:CanFam3.1:3:26944260:26982181:-1 gene:ENSCAFG00000008975 transcript:ENSCAFT00000014307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLNKAILRYLKNDGKIHLVVFNNLQLADGRRHRVLLRLTNLQRGAGSVELYLDCTQVD
SVHNLPRAFSGSSQSPDSIELRTFQRKAQDFLEELKLVVRGSLFQVASLQDCFLQQSEPL
ATTSTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLSFQSPTP
NTLVPPAPPAPATSPTPPVRRCDSNSCFRGVRCTDTRDGFQCGPCPEGYTGNGITCSDID
ECKYHPCYPGVRCVNLAPGFRCEACPVGFTGPVVQGIGISFAKSNKQVCTDIDECRNGAC
VLNSICINTLGSYRCGPCKPGYTGDQTRGCRTERSCRNPELNPCSVNAQCIEERQGDVTC
VCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCRYVPNSGQEDADGDGVGDACD
EDADGDGILNEQDNCVLTHNVDQRNSDKDIFGDACDNCRNILNNDQKDTDGDGKGDACDD
DMDGDGIKNILDNCPRVPNRDQRDKDGDGVGDACDSCPDVSNPNQSDVDNDLVGDSCDTN
QDSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPN
PAQEDSNRDGVGDICETDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDP
NWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSF
YVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWK
DSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQ
ENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLDS
Download sequence
Identical sequences F1PSS2
ENSCAFP00000013230 ENSCAFP00000013230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]