SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014051 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014051
Domain Number 1 Region: 784-985
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.23e-48
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 1019-1216
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.77e-45
Family BAR domain 0.002
Further Details:      
 
Domain Number 3 Region: 1520-1580
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-17
Family SH3-domain 0.0000249
Further Details:      
 
Domain Number 4 Region: 244-310
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 5 Region: 1284-1361
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000158
Family SH3-domain 0.00000896
Further Details:      
 
Domain Number 6 Region: 143-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 7 Region: 4-62
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000879
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 8 Region: 68-129
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000473
Family SH3-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014051   Gene: ENSCAFG00000009561   Transcript: ENSCAFT00000015184
Sequence length 1583
Comment pep:known chromosome:CanFam3.1:28:12751810:12825494:-1 gene:ENSCAFG00000009561 transcript:ENSCAFT00000015184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAIFDFCPSVSEELPLFVGDIIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGERLFVCISEFTSQELNSLPLHRGDLVILDDAPTASWLQGRSCWGARGFFPSSC
VRELCLSSQSRRWHSQSALLQIPEYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTVDELVSSGNHNDCIINGEEETPTGEEERGPEED
EEQPGTYGIALYRFQALEPNELDFEVGDKIRILGTLEDGWLEGSLKGRTGIFPYRFVKLF
SKTRAEETMDLPKESSPTEIPDTSLDCRENPLVVEGRHKSPEYKAEKSNCVISETSASPL
EHLTSECEVHKSSHQDEGTSRGPPRSPGWGHEQPLARHSPAEDPSETINGVSSQSQVPFR
PRWQQNQYYSTTGRGHLSTEQYSDPLPLEAKAKDYSSRPPRGMYSPPKTFQKPVPSPHGS
SCPLAPRVVRPSLLSSQLQSMVRGAKKYHTPKENASSFCSASERSEVKAGLQDRAFTADL
IALGQGGGHTDLDSKLTQQLVEFEKSLSGPGAEPEAILRHFSIMNFNSEKDIVRGSSKSI
TPQELPERRRALRPPPPRPSTPASTSPHVLLDQNLKPEPPLAMRPSRPAPLPPSAQHRVT
AVTPGLLTPGLFTHESCESPEKEGPENLDQTLDQTSQCPLVLVRIQEMEQDLDMCSPAPE
EPNLTLEEKQDESLRAETPEDLEFYESNIESLNMELQQLREMTLLSSQSSSPVAPPGSMY
TENPEQRMLEKRAKVIEELLQTERDYVRDLEMCIEHIMAPLQQTQIPNIDFEGLFGNMQM
VIKVSKQLLADLEISDAVGPVFLDHRDELEGTYKVYCQNHDEAISLLEIYEKDEKIQKHL
QDSLADLKSLYTEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKAPLTSA
VLAVKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTG
FAPQIKDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVSMWDVCMEKG
HRDLEQFEKVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYN
CTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQYAQGLFTNCIHGYAEAHCDF
VRQALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPAARKPFERKT
LDRQSARKPLLGLPSYMLQSEELRASLLTRYPPEKLFQAERNFNAAQDLDVSLLEGDLVG
VIKKKDPMGSQNRWLIDNGVSQGFVYSSFLKPYNTRRSHSDVSVGSHSSTESEQSSSSPR
FPRQNSSGTLTFNPGSMAVSFTSGSCQKQPQDATSPKELGQEILSASSNLGCSESSPSRC
PSDPDSSPQPRSWDSPEAARDISQPAPALRGYRNSRHPEIGGYSLPGRNGQGKDLTKGCA
RTTQALEDKNEEPESREAEGNQVYFAVYTFKARNPNELSVSANQRLKILEFKDVTGNTEW
WLAEVNGKKGYVPSNYIRKAEYT
Download sequence
Identical sequences E2RP94
ENSCAFP00000014051 ENSCAFP00000014051 XP_534988.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]