SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014113 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014113
Domain Number 1 Region: 3-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.98e-20
Family Ribosomal protein L24e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014113   Gene: ENSCAFG00000009601   Transcript: ENSCAFT00000015251
Sequence length 156
Comment pep:known chromosome:CanFam3.1:33:8018232:8023518:-1 gene:ENSCAFG00000009601 transcript:ENSCAFT00000015251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKK
GQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQA
SKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
Download sequence
Identical sequences A0A0H2UH99 A0A286X7X2 F1PGD7 F6TKN9 F6Y6W2 M3W052
ENSSTOP00000013125 ENSECAP00000021530 ENSMMUP00000019735 ENSECAP00000021530 ENSMMUP00000019735 9544.ENSMMUP00000019735 9796.ENSECAP00000021530 ENSCAFP00000014113 ENSCAFP00000014113 ENSSTOP00000013125 ENSFCAP00000003066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]