SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014527 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014527
Domain Number 1 Region: 3952-4323
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.59e-102
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 2959-3327
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.92e-100
Family Regulator of chromosome condensation RCC1 0.0013
Further Details:      
 
Domain Number 3 Region: 4460-4791
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.58e-88
Family Hect, E3 ligase catalytic domain 0.0000385
Further Details:      
 
Domain Number 4 Region: 423-779
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.18e-87
Family Regulator of chromosome condensation RCC1 0.0078
Further Details:      
 
Domain Number 5 Region: 2730-2912
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.32e-33
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 2555-2632
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.23e-29
Family CPH domain 0.00065
Further Details:      
 
Domain Number 7 Region: 1864-1930
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.62e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 8 Region: 1207-1291
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000602
Family Cytochrome b5 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000014527
Domain Number - Region: 2456-2508
Classification Level Classification E-value
Superfamily UBA-like 0.000746
Family UBA domain 0.0084
Further Details:      
 
Domain Number - Region: 3620-3710
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0209
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014527   Gene: ENSCAFG00000009863   Transcript: ENSCAFT00000015697
Sequence length 4837
Comment pep:known chromosome:CanFam3.1:3:31723022:31966293:-1 gene:ENSCAFG00000009863 transcript:ENSCAFT00000015697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDSFCLAAQTRLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIIYMGTELNQNGELPP
RKDDGVDTQSGTKKEDLNDKEKKDEEETPAPACRAKSILESWVWGKQPDVNELKECLSVL
VKEQQTLTIQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSSVSLPPVDK
KSSRPTGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEAS
LFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGSIPLQDQHLALAILLELAVQ
RGTLSQMLSAILLLLQLWDSGTQETDNERSAQGTSAPLLPLLQRFQSIICSKDAPHIEGD
THLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHK
GSLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNS
DTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPK
VISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAG
LKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDV
VKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGST
HCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSC
SEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGTADWPPPQEKECMAVATLNLLRLQ
LHAAISHQVDPEFLGLGLGSVLLNSLKQTVVALASSAGVLSTVQAAAQAVLQSGWSVLLP
TAEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDI
EAKKEAQKEKEIDEQEASASTFHRSRTPLDKDLINTGIYESSGKQCLPLVQLIQQLLRNI
ASQTVARLKDVARRISSCLDFEQHSRERTASLDLLLRFQRLLISKLYPGESIGQTSDISS
HELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVACIVEGDFTGVLLPELVV
SIVLLLSKNAGVMQEAGAVPLLGGLLEHLDRFNQLAPGKERDDHEELAWPGIMESFFTGQ
NCRNNEEVTQIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVV
ALEAALQFEDTRESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHASY
LAMSTPLSPVEIECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCS
DRRALGDHSQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEVGRL
LLCCLLKHEDLGHVALSLVHAGTLGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQG
RSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWRRIAQKIIRERRKKRV
PKKPESTDDEEKIGNEESDLEEACILPHSPISVDKRPITIKSPKDKWQPLLSTVTGVHKY
KWLKQNVQGLYPQSALLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLA
TKNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWA
VQNIRNVLMDANAKFKELGIQPVPLQTITNENPSGPSLGTTPQARFLLVMLSMLTLQHGA
NNLNLLLNSGMLALTQTALRLIGPSCDNVEEDMNASARGASATVLEETRKEMAPVQLPVS
GPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMG
KEGKYDLKLAELPASTQPSAEDSDTEDDSEAEQIERNIHPTAMMLTSTVNLLQTLCLSAG
VHAEVMQSEATKTLCGLLRMLVESGTTDKTSSPNRLVCREQHRSWCTLGFVRSIALTPHM
CAALSSPQWIALLMKVVEGHAPFTAASLQRQILAVHLLQAVLPSWDKTERARDMKCLVEK
LFGFLGSLLTTCSSDIPFLRESTLRRRRARPQASLTATHSSTLAEEVVALLRTLHSLGQW
NGLINKYINSQLHSVTRSCTGKPSEGALLEDYLPDSENPEVGGLMAVLAVIGGIDGRLRL
GGQVMHDEFGEGTVTRITPKGRITVQFSDMRMCRVCPLNQLKPLPAVAFSVINLPFTEPM
LSVWAQLVNLAGSKLEKHKVKKSPKQGFAGQVDLDLLRCQQLKLYILKAGRALLSHQDQL
RQILSQPAVQDVIAAHTDDGAAASPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFD
KQELEAAALAVCQCLAVESTHPSSPVFEDCSSSEATTPVPVQHVRPVRAKKRKQSPAPAL
PIVVQLMEMGFPRRNIEFALKSLPGASGNAAGLPGVEALVGWLLDHADAQVTDLSDADTG
SEECSDEEVVEDVDDVAYAVSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRC
CRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSPSHI
KIGDKVRVKSSVTTPKYKWGSVTHQSVGIVKAFSANGKDVIVDFPQQSHWTGLLSEMELV
PSVHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTRKHNTRHTFGRINEPGQSAIF
CGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHW
IRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPTDTTVSLLN
DCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGN
SGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAG
GSKSLFAVTVEGKVYACGEATNGRLGLGLSSGTVPIPRQITALSSYVVKKVAVHSGGRHA
TALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGE
LYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGD
GDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGH
GSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDAGQVYAWGDNDHGQQGNGTTTVNRK
PTLVQGLEGQKITRVACGSSHSVAWTTIDVATPSVHEPVLFQTARDPLGASYLGVPSDAD
SSAASNKINGANNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGALMP
AGMMAPVECPSFSSSAPPSDVSAMASPVNGEEFVLPVDIEDRLSPNPWQEKRGEMISSED
AVTPSAVTPSASSTSSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKASGPEPQSLDEF
TSLLVADDTRVMVDLLKLSVCSRAGDRGREVLSAVLSGMGTAYPQVADMLLELCVTELED
VATDSQSGRLSSQPVVVESSHPYTDDTSSSGTVKIPGAEGLRVEFDRQCSTERRHDPLTV
MDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKD
LLSDRCVLSCPSMDLVTCLLDFRLNLTSNRSIVPRLAASLAACAQLSALAASHRMWALQR
LRKLLTTEFGQSININRLLGDNDGEARALSFTGSALAALVKGLPEALQRQFEYEDPIVRG
GKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLF
LDEVAKKIRELMADSEHMDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGW
GHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRL
GIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRS
PCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLV
EALQGHRVVDVACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGL
GVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATG
SLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWS
TSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSLDETG
LGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGP
DGTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGL
TPLLIVTPNGRDESGANRDCYLFSPAARAPVHTNMFRFLGVLLGIAIRTGSPLSLNLAEP
VWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSS
KYTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGS
PDIPLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFR
GRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYA
RIALTGEPAADDSSDDSENEDVDSFASDSTQDYLTGH
Download sequence
Identical sequences E2RDC2
ENSCAFP00000014527 ENSCAFP00000014527 XP_013967757.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]