SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015353 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015353
Domain Number 1 Region: 148-220
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00000000000889
Family Pyk2-associated protein beta ARF-GAP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015353   Gene: ENSCAFG00000010465   Transcript: ENSCAFT00000016591
Sequence length 653
Comment pep:novel chromosome:CanFam3.1:25:40117104:40141555:1 gene:ENSCAFG00000010465 transcript:ENSCAFT00000016591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEISRIQYEMEYTEGISQQMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVA
GNNEDIPFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPPTPQNEEIRA
VGRLKRERSMSENAVRQNGQLVRADSMRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVC
KQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSAS
STSSTPEVKPLKSLLGDSAPALHLNKGTPSQSPVVGRSQAQQQEKKQFDLLSDLGSDIFA
APAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSASSNFGGFPTASHSPFQPQ
TTGGSAGSVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKASLQSTDKYAA
LANLDNIFSAGQGGDQGSGFGATGKAPVGSVVSVPGQSSTSSDKYAALAELDSVFSSAAT
SSNAYTSTSNASSNVFGTVPVGASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTN
PFQTNARGATAATFGTASMSMPAGFGTPAPYSLPTSFSGSFQQPAFPAQATFPQQTAFSQ
QPNGASFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL
Download sequence
Identical sequences E2RNM4
ENSCAFP00000015346 ENSCAFP00000015353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]