SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016019 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016019
Domain Number 1 Region: 85-289
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-48
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 333-516
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.44e-37
Family BAR domain 0.016
Further Details:      
 
Domain Number 3 Region: 569-655
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000336
Family SH3-domain 0.0000967
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016019   Gene: ENSCAFG00000010897   Transcript: ENSCAFT00000017308
Sequence length 738
Comment pep:novel chromosome:CanFam3.1:32:26383609:26530856:1 gene:ENSCAFG00000010897 transcript:ENSCAFT00000017308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPREAGGKESMGTKRKNLTFLRPRLYMLERRKTDTVVDGGAPGEHSGALRRSQSDRTEY
SQKLQEKMTPQAGASATETLTQEEHRMQRMMAKRSKIIKELIQTEKDYLNDLELCIREVV
QPLRNKQIDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPLE
DIYKIYCYHHDEAHSVLESYEKEEELKQHLSHCIQSLKKIYMQEGKPNLLDMGSLMIKPI
QRVMKYPLLLCELQGSTPPSHPDFGALGDAFIAVKDINVNINEFKRRKDLVLKYKKNDED
ESLKDKLSKLNIHSISKKSKRVTNHLKILTRGEPQVKDNTFNREEKLFRYLEKTVRHCVK
NISLCLQHIQDAMPLALQSMMELQEISCNKNKEERSHSEALSNAPNPCGDFAAHVQRLVL
MPLSALLSLFTGPQKLIQKRYDKLLDCNSHLPRAAGDDSDLAKKEYEALNAQLVEELQVF
NRAARKILHNCLCSFVALLRDLTLAAQQVYSTVAPVPLLAPRISEIQNRVLEEVQNLNFV
KDNSATFIERKLSFEKKKPLQIPPEVPRQTDIHRSKLLSTYGKEELYQAKRKCNATQEYD
INLLEGELVAVMEQKDPLGSTSRWLVDTGIIRGYVYSSFLKPYNPAKVQKVDAENRFGDD
DFDNISLFVSSRPASDSVTGTPESSISDSSSSLSGTYGKLETNGTDVDSSQEVDEQVPFE
MDDNLNQCLEPMIHQAVP
Download sequence
Identical sequences E2QUS3
ENSCAFP00000016019 ENSCAFP00000016019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]