SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017824 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017824
Domain Number 1 Region: 47-173
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 3.79e-58
Family N-terminal domain of cbl (N-cbl) 0.000000203
Further Details:      
 
Domain Number 2 Region: 260-346
Classification Level Classification E-value
Superfamily SH2 domain 2.09e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 352-430
Classification Level Classification E-value
Superfamily RING/U-box 8.17e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 174-259
Classification Level Classification E-value
Superfamily EF-hand 2.14e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 857-895
Classification Level Classification E-value
Superfamily UBA-like 0.0000181
Family UBA domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017824   Gene: ENSCAFG00000012100   Transcript: ENSCAFT00000019218
Sequence length 908
Comment pep:novel chromosome:CanFam3.1:5:14607322:14676908:-1 gene:ENSCAFG00000012100 transcript:ENSCAFT00000019218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNVKKSSGAGGGGGSGGSGGLIGLMKDAFQPHHHHHHLSPHPPGTDKKMVEKCWKLMD
KVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMK
KTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKA
DAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIF
TRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWA
IGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVT
QEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIK
GTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYEDDDDERADDSLFMMKELAGAKVERPPSP
FSMAPQAPLPPVPPRLDLLQQRVSVPSSASGLGTASKVASGSLHKDKPLPIPPTLRDLPP
PPPPDRPYSVGTDTRPQRRPLPCTPGDCPSRDKLPPVPSSRLGESWLPRPIPKVPVVAPN
SSDPWTSGRELTNRHSLPFSLPSQMPRTDVPRLGGTFNVDTSMNVNNSPLASSECEHPKI
KPSASANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLGLPKPDGKRPLETTQS
SRFRACDCDQQIDSCTYEAMYNIQSQATPSVTESSTFGEGSLAAAHISTGPEESENEEDG
YDVPKPPMPAVLARRTLSDISNASSSFGWLSLEGDPTTNFTEGSQVPERPPKPFPRRINS
ERKAGSCQQGGAAAASPQLSSEIENLLSQGYSYQDIQKALVIAHNNIEMAKNILREFVSI
SSPAHVAT
Download sequence
Identical sequences F1P861
ENSCAFP00000017824 ENSCAFP00000017824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]