SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018793 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018793
Domain Number 1 Region: 68-178
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.09e-38
Family Supernatant protein factor (SPF), C-terminal domain 0.000000818
Further Details:      
 
Domain Number 2 Region: 12-66
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000116
Family CRAL/TRIO domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018793   Gene: ENSCAFG00000012757   Transcript: ENSCAFT00000020256
Sequence length 191
Comment pep:novel chromosome:CanFam3.1:26:23581202:23583492:-1 gene:ENSCAFG00000012757 transcript:ENSCAFT00000020256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDNNPSTPLPTDNWKEGLLKLISPEELPAHFGGALTDPDGNPKCLTKINYGGEIPKSMY
VRDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFLKTKMGERQR
AGEMTEVLPSQRYNAHMVPEDGSLTCSEAGVYVLRFDNTYSFVHAKKVSFTVEVLLPDEG
MQKYDKELTPI
Download sequence
Identical sequences E2RM47
ENSCAFP00000018793 ENSCAFP00000018793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]