SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019188 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019188
Domain Number 1 Region: 290-417
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-16
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000019188
Domain Number - Region: 22-78
Classification Level Classification E-value
Superfamily HR1 repeat 0.0128
Family HR1 repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019188   Gene: ENSCAFG00000013018   Transcript: ENSCAFT00000020673
Sequence length 608
Comment pep:novel chromosome:CanFam3.1:4:14163319:14245946:-1 gene:ENSCAFG00000013018 transcript:ENSCAFT00000020673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGPSGRRPELRPAGLPAQQDCSIQEKIDLEIRMREGIWKLLSLSTQKDQILHAVKNLMV
CNARIMAYTLELQKLEEQIANQIGRCDVNFESKERTACKGKIAISDIRIPLMWKDSDHFS
NKERSQHYAIFCLFKMGAEVFDTDMMIVDKTITDICFENVTIFNEAEPDFQVKVEVYSCC
IEDSSITNTPKKLAKKLKTSISKATGKKINLVLQEDHETCSSISLGVYGAKYNLLAHATL
TLESAEDSFKTHNLSINGNEESSFWLPLYGNMCCRLVAQPACMAEDAFAGFLNQQQMAES
LISWRRLYCVLRGGKLYCFYTPEEIEAKVEPALVVAINKETRIRAMDKDAKKKIHNFSVI
NPVAGQSVTHIFAVDNREDLQKWMEAFWQHFFDLSQWKHCCEELMKIEIMSPRKPPLFLT
KEATSVYHDMSIDSPIKLESLTDSIQKNLEETNGQLLVGQHEESSPPLWASLFDGNHQMV
IQKKVLSPTSKQLHDGKGKKRRAPLPPSDQAPFSLKTQSNTDQFVKDNWEKTSVSWTSPL
DSKLSTLMHHLQKPMAAPRKLLPARKNYLSDGERMDSKTSFEAKPVPAPRQKSVKGMLDP
RSWLQAQV
Download sequence
Identical sequences E2RP85
ENSCAFP00000019185 ENSCAFP00000019188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]