SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019378 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019378
Domain Number 1 Region: 1008-1104
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-26
Family PDZ domain 0.00035
Further Details:      
 
Domain Number 2 Region: 393-498
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-23
Family PDZ domain 0.0000496
Further Details:      
 
Domain Number 3 Region: 837-937
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-23
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 698-810
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-22
Family PDZ domain 0.00048
Further Details:      
 
Domain Number 5 Region: 552-662
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-17
Family PDZ domain 0.00024
Further Details:      
 
Domain Number 6 Region: 123-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 289-326
Classification Level Classification E-value
Superfamily WW domain 0.000000000000237
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 16-111
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000092
Family PDZ domain 0.042
Further Details:      
 
Domain Number 9 Region: 337-371
Classification Level Classification E-value
Superfamily WW domain 0.00000000128
Family WW domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019378   Gene: ENSCAFG00000013122   Transcript: ENSCAFT00000020871
Sequence length 1490
Comment pep:known chromosome:CanFam3.1:17:62057610:62151074:-1 gene:ENSCAFG00000013122 transcript:ENSCAFT00000020871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLREEPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTHRDTLAVIRHFREPVRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEE
EDEDKEAVNGSGTAENRERHSESSDWMKTVPSYNQTNSSMDFRNYMMRDENLEPLPKNWE
MAYTDTGMVYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQADTGSSKPDMEKSHFTRDPSQLKGVLIRASLKKSTMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLV
PVNQYVNLTLCRGYPLPDDNEDSVVDIVAATPVINGQSLTKGEICMNTQDFKSGAVVLEQ
NGKPGHSLISDRLNGPSDPSEQRASLASSGSSQPELVTVPLIKGPKGFGFAIADSPTGQK
VKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSP
TKTAKMKTDTKENLGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPP
NTKDLDVFLRKQESGFGFRVLGGEGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIP
VKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSSQALLSAQNGSPRLNRAEV
PARPALQEAYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCGKLKIG
DHISAVNGQSIVELSHDSIVQLIKDAGVTVTLTVVAEEEHHGPPSGTNSARQSPAMHHRP
MGQSQANHLPGDRSALEGDIGKDVSMSYRHSWSDHKHLAQPDTAMISVVGSRHDQSLGCH
PVELERGPRGFGFSLRGGKEYNMGLFILRLAEEGPAIKDGRIHVGDQIVEINGEPTQGIT
HTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDVTNPSSSNVIYDEQPPCPPSSHCPSVF
EASPVPGVEESLTRAQIYEKTEELKDGVPEKKSTFNENQSDKKQPSFLQKNVNKRDPPSS
THGQSDKKNLLRVENDVTPRGRSASPRKPALRHVEERPDKLPTPLTADPPRRPRDRSLSP
RNRSLSPRKGDRKGGQMGARAESGQEHCKRSRGRSASPKKQPRTEGSRGRANAEARLLGC
DGQRGGGRAGDGAEQTSEGKEESGVVRKDTKQSLPGKNRTRSPETKSKRMDEKSLPSKKP
SPTASKVLPDGEKGRKATSGETSSSKEKMGENAKIPDKKRKQDPEERMVLNKAKAPQGRE
QEAADKTRESGGVRPESTSPVKKTPITPGPWKVPSANKATGTTGVAEKRL
Download sequence
Identical sequences J9P535
XP_005630899.1.84170 ENSCAFP00000019378 ENSCAFP00000040711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]