SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019381 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019381
Domain Number 1 Region: 143-479
Classification Level Classification E-value
Superfamily Subtilisin-like 1.09e-88
Family Subtilases 0.0000000238
Further Details:      
 
Domain Number 2 Region: 474-619
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.57e-35
Family Proprotein convertase P-domain 0.00077
Further Details:      
 
Domain Number 3 Region: 53-133
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000187
Family Prohormone convertase 1 pro-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019381   Gene: ENSCAFG00000013143   Transcript: ENSCAFT00000020874
Sequence length 787
Comment pep:known chromosome:CanFam3.1:5:16368220:16388937:1 gene:ENSCAFG00000013143 transcript:ENSCAFT00000020874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKGRQKVPHSDAPLGLPTHLWLELAGLFLLVPWVMGLAETDRPGAQGPGGLSWAVHLDS
LEGEGQEETLEQQADALAQAAGLLNAGRIGELQGYYLFTQPAGHQQEQQVEALRQQAETV
LARHEAVRWHSEQRLLKRAKRSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRG
VTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVP
NNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP
HQLGKAALQHGVIAGRRGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRM
PFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML
QVRPCLTWRDVQHIIVFTATQYEDRRADWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWT
SVPYLASYVSPVLKENKAIPLSPHSLEVLWNVSRTDLEMSGLKTLEHVAVTVSITHPRRG
SLELKLFCPSGMMSLIGAPRSMDSDPNGFNDWTFSTVRCWGERAKGTYRLMVRDVGDETL
QPGILQQWQLTLYGSVWSPVDIKDRQRLLESAMSGKYLHDGFTLPCPPGLKIPEEDGYTI
TPNTLKTLVLVGSFTIFWTVYYMLEIYLSQRNVATHRVCRSGPCHWPQRSQKAREEGTEL
ESVPLCNSKDPDGVETEREGPPTTSDPLAPDLLAPGDWGPSQDRSTLNCPHHHLAPDLLQ
GKEEQIC
Download sequence
Identical sequences E2REE0
XP_850224.1.84170 9615.ENSCAFP00000019381 ENSCAFP00000019381 ENSCAFP00000019381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]