SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019493 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019493
Domain Number 1 Region: 706-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000893
Family Laminin-type module 0.0000586
Further Details:      
 
Domain Number 2 Region: 602-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000698
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 164-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 4 Region: 762-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000024
Family Laminin-type module 0.00015
Further Details:      
 
Domain Number 5 Region: 813-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 6 Region: 323-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 7 Region: 276-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 220-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 651-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000046
Family Laminin-type module 0.00023
Further Details:      
 
Domain Number 10 Region: 861-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000218
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000019493
Domain Number - Region: 1157-1405
Classification Level Classification E-value
Superfamily Tropomyosin 0.000464
Family Tropomyosin 0.001
Further Details:      
 
Domain Number - Region: 960-1158
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000645
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019493   Gene: ENSCAFG00000013234   Transcript: ENSCAFT00000020993
Sequence length 1487
Comment pep:known chromosome:CanFam3.1:7:16406353:16529051:1 gene:ENSCAFG00000013234 transcript:ENSCAFT00000020993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREGGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCQGNTDGANCERCRENFFRLVSHEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGEKCDRCQPGYHSLTEAGCRPCSCNPAGSIDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSITSTFQIDEDGWRVEQRDGSEASLEWSS
ERQDIAVISDSYFPRYFIAPAKFLGKQVWSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTMKYVFRLHEATDYPWRPPLSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLTSARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTTGSSSDCQPCPCPGGSSCA
VVPKTQEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCRACACNPYGTVKQQSSCNPVT
GQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCEHCEVNHFGFGPEGCKPCDCHPEGSVSLQCKDDGRCECKQGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVADHRVKLQELENLIANLGTGEEVVTDQAFEDRLKEAEREV
MDLLREAQDVKDVDQNLMDRLQRVNSTLSSQISRLQNIRNTIEETGNLAEQARARVESTE
QLIEIASRELEKAKIAVANVSITQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANDTSTEAYNLLLKTLAGENQTALEIEELNRKYEQAKNISEDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAEDLDHLIDQKLKDYEDLREDMRGKELEVK
KLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINQTIIEANEKTREAQLALGNAAADATEAKSKAHEAERIASAVQKNATS
TKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEIN
ARKAKNSVTSLLSLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLE
NEARKQEAAIMDYNRDIEEIMKDIRNLEDIKKTLPTGCFNTPSIEKP
Download sequence
Identical sequences F1PHK9
ENSCAFP00000019493 XP_013970599.1.84170 ENSCAFP00000019493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]