SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019561 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019561
Domain Number 1 Region: 13-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.15e-75
Family BAR domain 0.0000000809
Further Details:      
 
Domain Number 2 Region: 289-349
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-21
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019561   Gene: ENSCAFG00000013237   Transcript: ENSCAFT00000021065
Sequence length 351
Comment pep:novel chromosome:CanFam3.1:3:55287275:55340281:1 gene:ENSCAFG00000013237 transcript:ENSCAFT00000021065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKKKKKKKRKEKKKELFSEKISGVEGTKLDDEFLDMERKIDITNKAVAEILSKATEYLQP
NPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEGSTFGNALIEVGES
MKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPD
EEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHKQSTEILQELQSKL
QMRISAASSVPKREYKPRPIKRSPNSGPSLHHYPLPTFSKVMWTGSNVAMDQPCCRGLYD
FEPENQGELGFKEGDVITLTNQIDENWYEGMLHGESGFFPINYVEVIVPLP
Download sequence
Identical sequences F1PFB5
ENSCAFP00000019561 ENSCAFP00000019561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]